SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G02380.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G02380.2
Domain Number 1 Region: 43-253
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.54e-64
Family BC ATP-binding domain-like 0.00000249
Further Details:      
 
Domain Number 2 Region: 257-373
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.04e-35
Family BC C-terminal domain-like 0.00034
Further Details:      
 
Domain Number 3 Region: 549-619
Classification Level Classification E-value
Superfamily Single hybrid motif 2.22e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G02380.2   Gene: BRADI4G02380   Transcript: BRADI4G02380.2
Sequence length 625
Comment pep:novel chromosome:Brachy1.0:4:1555580:1562057:-1 gene:BRADI4G02380 transcript:BRADI4G02380.2
Sequence
MVFYQKAQISRNSVKLRALHSSGHRRLQSVIWAIRGHFVNNSASKRIMGAAGVPLVPGYH
GAEQDIELLKLEADKIGYPVLIKPTHGGGGKGMRIVQGPDDFVDSVLSAQREAAASFGIN
TLLIEKYITQPRHIEVQVFGDQHGNAIHLYERDCSLQRRHQKIIEEAPAPNVTTEFRSHI
GEAAVSAAKAVGYYSAGTVEFIVDTISGEFYFMEMNTRLQVEHPVTEMIVGQDLVEWQIR
VANGERLPLSQEQVQLNGHAFEARIYAENVPRGFLPATGTLHHYRPVTSSKTVRVETGVE
EGDTVSMHYDPMIAKLVVWGESRNAALVKLKNCLSNFQIAGLPTNVGFLQELAGHSAFEK
ALVETHFIERYKDDLLSTSAKTSDESHDAVELGAILAAACICKKDHIASEESLRDKTLSV
WYSGSPFRMHHSAKRLMEFEIDKELEGLSDEPLKLHITYKSDGSYFIETIDGSSPGLEIK
LDDRSDHDFRVDVGGVQKDVTLAFYTKDDSKHIHIWHGKHHHHYRQTMRAEQSLDDSSQP
SHASEGRSYPKGSVLAPMAGLVVKVLLKDGAQVENGQPVMVMEAMKMEHVVKAPRAGYIQ
GLKATAGQQVFDSSVLFTVQDKSTN
Download sequence
Identical sequences I1IGN7
EG:BRADI4G02380.2 XP_014758492.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]