SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G04100.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G04100.1
Domain Number 1 Region: 618-684
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-22
Family Protein kinases, catalytic subunit 0.0039
Further Details:      
 
Domain Number 2 Region: 429-518
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000102
Family Polygalacturonase inhibiting protein PGIP 0.034
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G04100.1
Domain Number - Region: 262-328
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00592
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G04100.1   Gene: BRADI4G04100   Transcript: BRADI4G04100.1
Sequence length 783
Comment pep:novel chromosome:Brachy1.0:4:3341822:3346806:-1 gene:BRADI4G04100 transcript:BRADI4G04100.1
Sequence
MASAMATTGSHRRQLLLIFVLTFYFLSSELRVVHGQPDTLGFISIDCGTAEGTSYPDEST
NGLRYVSDAGFVDAGAGANAGISPPYSDRGLAPRYLNVRYFFAPSGGSGGGNNRRSCYTL
RGLTQGAKYLVRCSFYYGNYDQLSRLPAFDLYLGVHRWAAVNVTAADDTYILEAVTVSPA
EFLQVCLVDIGLGTPFISGLDLRPLRAAMYPEATANQSLLLLNFRRPTARFALNRYHFWR
PASSYRVFRYPFDSHDRLWQSYGDVTAWTNITTATTVDIKNSSSFDEPSVVLQSAATPVN
GTQLDFSWSPDPSLNNDNNSTAYLLLLYFAELQRLPSGALRRFDVLVDGASWDGSRSYSP
KYLSAEVVERVVVQGSGQHTVSLVATPDATLPPILNAFEIYSVRQTAELGTNNGDAEAMM
AIRTAYALKKNWMGDPCAPKAFAWDGLNCSYSSSGSAQIKAINLSSSVLTGAVDPSFGDL
KSLQHLDLSNNSLSGSIPVFLAQMPSLTFLHRCSNARIGNNANICDNGASTCDSEDKGKY
RTLVIAIAVPIAVATLLFVAAILILHKRRNKQVGLIPDTWTAHNTRLNSPRERSNLFENR
QFSYKELKLITGEASVATPLSWHQRLKIALDSAKGLEYLHKSCQPPLIHRDVKTKNILLS
ANLEAKICDFGLSKVFADEFMTHITTQPAVWKVTELALQCKEQPSRERPTMTDIVAELKE
CLELELSRGMGSYSSVTSGANNLSATSADLHSDAQGSDLRQQSVLELGQVGDASATRIGP
IPR
Download sequence
Identical sequences I1IHB8
15368.BRADI4G04100.1 EG:BRADI4G04100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]