SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G04120.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G04120.2
Domain Number 1 Region: 99-246
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.67e-53
Family C-terminal domain of ribosomal protein L2 0.00000668
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.47e-20
Family Cold shock DNA-binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G04120.2   Gene: BRADI4G04120   Transcript: BRADI4G04120.2
Sequence length 261
Comment pep:novel chromosome:Brachy1.0:4:3355874:3357782:1 gene:BRADI4G04120 transcript:BRADI4G04120.2
Sequence
MGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAK
VTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSVGNVLPLRSVPEGGVICNVEHHV
GDRGVFARASGDYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEKPML
KAGNAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAA
RRTGRLRGQAAASAAKADKAT
Download sequence
Identical sequences I1IHC0
EG:BRADI4G04120.2 15368.BRADI4G04120.2 XP_010237139.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]