SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G04290.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G04290.1
Domain Number 1 Region: 30-91
Classification Level Classification E-value
Superfamily Tim10-like 5.1e-20
Family Tim10/DDP 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G04290.1   Gene: BRADI4G04290   Transcript: BRADI4G04290.1
Sequence length 95
Comment pep:novel chromosome:Brachy1.0:4:3518662:3520740:1 gene:BRADI4G04290 transcript:BRADI4G04290.1
Sequence
MDKGMGMLGDLDNLPDEDKMRMASMVDQLQIRDSLRMYNSLVERCFTDCVDTFRRKTLDK
QEESCVRRCAEKFLKHSMRVGMRFAELNQGVATPD
Download sequence
Identical sequences I1IHD7
EG:BRADI4G04290.1 XP_003578989.1.954 15368.BRADI4G04290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]