SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G04347.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G04347.1
Domain Number 1 Region: 416-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-68
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 260-353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G04347.1   Gene: BRADI4G04347   Transcript: BRADI4G04347.1
Sequence length 752
Comment pep:novel chromosome:Brachy1.0:4:3564837:3567335:-1 gene:BRADI4G04347 transcript:BRADI4G04347.1
Sequence
MEHRTLLLPLAVVVTTLLVSTTWQQLASAAECQRRCGGVDIPYPFGIGRGCFLESPDMAF
SLTCNLTAGDGNTSTRRPFSGALELLDVRLGRGQVRVRNRISSWCGHNGTPSMASGGSQL
LPSSFRVSDAANRFTVIGCDALAYVGADADNGVIGMYSVGCRSMCPSAARLANGSSCSGM
GCCQAAVPPGLSRYQVWFEDELNSSSSGRGAMSRPCSYAVLVEAAAFEFRTTYVTTGEFM
EATGGQVPLVLDWVAGNQTCLEAKTQAAGYKCLSGNSECVDSRNGPGYLCNCSAGYQGNP
YVLNGCQDIDECEQTGAAYPCSAPDTCSNTAGGFRCLCPAGHSGNAYTGPCEQKRSERPW
QAAIGVSVGVVVLAVGMSCTYAAQEKRRLAAIKARHFRQHGGLLLFEEMKNKGNNGMVSS
SSFTLFTREELREATGGFDERHVLGRGGNGTVYRGTLRDGTAVAIKRCRAAADGIDDDDG
GRRQREFGKETLILSQINHKNIVKLYGCCLEVEVPMLVYQFIPNGTLYHLLHGGSDNNGE
SAAVPFAVRLRIAHETAEALAYLHSMASPPVIHGDVKSPNILLDGAYAAKVSDFGAATLA
PPTDEAHLVTFVQGTCGYLDPEYMQTCRLTEKSDVYSFGVVLLELLTSRKALNLAAPDDE
RSLAASFLSAARDGRLDGLLDARVKGEVEAEVLEMVAGIAKMCLEMSGERRPSMRVVAEE
LDRIRKMSSSALQRSCLDEAQAHSVLDGISDR
Download sequence
Identical sequences I1IHE3
XP_014757736.1.954 EG:BRADI4G04347.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]