SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G06017.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI4G06017.1
Domain Number - Region: 152-252
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00051
Family Myosin rod fragments 0.015
Further Details:      
 
Domain Number - Region: 377-483
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G06017.1   Gene: BRADI4G06017   Transcript: BRADI4G06017.1
Sequence length 513
Comment pep:novel chromosome:Brachy1.0:4:4987194:4988893:-1 gene:BRADI4G06017 transcript:BRADI4G06017.1
Sequence
MAKKKSSHAAAAAANGNGNGHGLDHAAPAPGMAEAYATEEKRDSSPERDRKAEQLKTLNT
MLLREAVERRGQVAALTARLDELSADGDALAASERAVARAALAAPLRAAADEAAALRARL
DAVQDSLRLAESKAALEASAKDEANARLEAAAGEKVRFLELLRVKEAEVASISNKVSSLA
AMMAELEGNNSELFSQNDELVKQLEETKEAVRAVSSQKAEVERSFQEFKKEAEAYRVEME
GVVKAKVEELKLLGFKKAEMDARVTSLETELAVAVTKTGGLEAEMMAKKREFDLLKGESD
KLRSEVTAAEKKHSLSAAEVERLRIELDALVKAKEAAIKSFDAEKAEVLKELENLKRKVG
EIQADKEAAEGATREKDAQAIKLRAELEELHVSMSQLQTSYDEVDAKRLCLHSEKNSVQK
ALDAEKAEAGQLRSKIEALENCNGKMDSEIGELRVALKEKNGKIKDLTNEAEQLQLAVAE
AQKRKKGGIWAWVYAATTTMVAAISLIYATRAQ
Download sequence
Identical sequences I1IHY7
EG:BRADI4G06017.1 XP_003575862.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]