SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G06087.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G06087.1
Domain Number 1 Region: 9-204,308-476
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.65e-125
Family Eukaryotic glutathione synthetase ATP-binding domain 0.00000122
Further Details:      
 
Domain Number 2 Region: 207-310
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.75e-37
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G06087.1   Gene: BRADI4G06087   Transcript: BRADI4G06087.1
Sequence length 478
Comment pep:novel chromosome:Brachy1.0:4:5050945:5055980:-1 gene:BRADI4G06087 transcript:BRADI4G06087.1
Sequence
MSTAKGNPPSPDPAAVEEMARDATAWCAMHGLVVGDRAEQRSGTVPGVGLVHAPISLLPA
RLPESFWSQACELAPIFNELVDRVSLDGDFLQDSLSKTRQVDDFTSRLLEIHRKMMDINK
EENIRLGLHRSDYMLDSETNSLLQIEMNTISVSFPGLCSLVTKLHRVLINQYGNLLCLDS
KRIPENVASQQFAEALSRAWDEFNVDSAVVMMIVQPEERNMYDQYWIVKYLKESHGVTTI
RKTLSEVEAESQVLPDGTLVVDGRTVAVVYFRAGYTPNDYPSEAEWSARLLMEQSSAVKC
PSISYHLVGTKKIQQELAKPNVLERFLENKEEIAKLRQCFAGLWSLDDEEIVKSAIETPD
LFVLKPQREGGGNNIYGLDVRETLIRLQKEGGDALSAYILMQRIFPKASLANLVRGGVSH
EALTISELGIYGAYLRNKDKVVMNDQCGYLMRTKVSSSDEGGVAAGFAVLDSLYLTDK
Download sequence
Identical sequences I1IHZ4
EG:BRADI4G06087.1 XP_010237217.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]