SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G06540.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI4G06540.1
Domain Number - Region: 92-162
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000578
Family NRPS condensation domain (amide synthase) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G06540.1   Gene: BRADI4G06540   Transcript: BRADI4G06540.1
Sequence length 617
Comment pep:novel chromosome:Brachy1.0:4:5493829:5496273:1 gene:BRADI4G06540 transcript:BRADI4G06540.1
Sequence
MAATKNGNANNAGSGFISVRVRPRRPTGAGEGDYYKAVCAAFEAHLPSYLNYMFPLAGRI
IHNPTSGLPELHCRNQGAELVLAEAGAAELWAVDWSRPNESLKKIPLPFAQELPLSVQLV
SFACGGFAVVWGVHHLVGDGSFGAMLVNTWSELVRTGAIGAARIPTHDRSLSFFRPRDPP
SYGAAVDGMFRRWDSAGAGHVNALTAEESFTRRLYFVHERDIARLRRMASAAAGGRRATT
RAEALSAYLWKLLAGVVASSARLLSEAAAGEKRCRMLWFVDGRPRLTSSPDQVRHALRNY
AGNVTSYVLAEASAATVLSKSLAEVAAMARDAITAPNYDELYQDMVDWVELHKPASFVET
PAVGLGSPTLAQTVWASYRIHTDFGFGHAALAVPLDAKEGGLCSGHLYVSSSSPGTGDRS
WVVNACIWPRLAAALESDREKVFQPLAAEHLGLTCSGGADYLRQDAERPRLSSLDLQMGV
HVFDGMASLLDCTSVESLIPNGSKRIVGFISGSGDAKAKPPSGPAARAAPMSPLPSSTRP
VRVQSKLGLDREHAGDGGGGGAGTGTGGAVGGAPRWLVGTGNIGGAVGVGAHGMSGPRQR
VLGKQSKQAKRKPIYCL
Download sequence
Identical sequences I1II44
EG:BRADI4G06540.1 15368.BRADI4G06540.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]