SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G08560.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G08560.1
Domain Number 1 Region: 89-352
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.85e-42
Family Protein kinases, catalytic subunit 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G08560.1   Gene: BRADI4G08560   Transcript: BRADI4G08560.1
Sequence length 362
Comment pep:novel chromosome:Brachy1.0:4:7667745:7673085:1 gene:BRADI4G08560 transcript:BRADI4G08560.1
Sequence
MGCSFSGLNALYDTVGGGGGGDVWVNDYRFRVLRRLGDAGPAGSSVFLVKEIVAAASAAS
DAGAGGGAGPGPVGLAKKKGVDPSHISADGTYALKKVLIQSDQHLQLVRQEIRVSSQFSH
PNLLPLLENAIIAVKGVQDGSQNHEAYLLFPVHLDGTLQDATKSMLEKKEYFPTITILQI
FRQLCAGLKHMHSFEPPYAHNGVKPDNVLITLRKEQPHLAILMDFESARPARRAIRSQAE
ALQLQEWASEHCSAHYRAPELWECPSHADIDERTDVWSLGCTLYAMMYGKSPFDYELDES
AGETLVKVIKSAQVKWSTETGSSYPDALRQFVTWMLQPQPTVRPHIDDIIFHVDKLIAKY
ST
Download sequence
Identical sequences I1IIU4
XP_010237321.1.954 15368.BRADI4G08560.1 EG:BRADI4G08560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]