SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G08727.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G08727.2
Domain Number 1 Region: 218-317
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.19e-24
Family Canonical RBD 0.0038
Further Details:      
 
Domain Number 2 Region: 116-212
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.12e-21
Family Canonical RBD 0.0024
Further Details:      
 
Domain Number 3 Region: 610-652
Classification Level Classification E-value
Superfamily WW domain 0.000000000104
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G08727.2   Gene: BRADI4G08727   Transcript: BRADI4G08727.2
Sequence length 746
Comment pep:novel chromosome:Brachy1.0:4:7842582:7850879:-1 gene:BRADI4G08727 transcript:BRADI4G08727.2
Sequence
MHRGSDRTGDLPGPAGGARSGGDGRFARGPSRWSGGGGGGGGGGGSPPHRSSSRGGAGDG
GGGGRFHPYRGPSEYSVGTGGSGGYRGGGGGGDFGDTAGGPRNRYGGGGGGGGRGDHSDH
DNKSGYVKLFVGSVPRTANEDDVRPLFADHGDVLEVALIRDRKTGEQQGCCFVKYATSEE
AERAIRALHNQCTIPGAMGPVQVRYADGEKERHGSIEHKLFVASLNKQATAKEIEEIFSP
FGHVEDVYIMKDGMRQSRGCGFVKFSSKEPALAAMNSLSGTYGCEQPLIVRFADPKRPRP
GESRGGPAFGGPGVSPRSDAALVIRPTANLDEPRGRHMPPDSWHPSSPNSMAPHQFNNNF
GSDNHMGLMGGSVASADNAAFRPQMFHGNGSLSTQTALPTSSHMGMNPSISQGHHLGGQQ
ILPLQKAPGPLHNFPVQLQNAQQGQLQQIGQHHVPQSLGPSSLSQHIPAMPLPGQLPVSQ
PLTQQNTSAGALQAPSAVQSNLMQAVPGQQQLTSNVAPQMLQQAMQQMPSQAPQLLLQQQ
AALQSSYQSSQQAIFQLQQQLQLMQQHQQQPNLNQQPHTQVPKQQGQPMVQSSTPGALAA
VVPTNINAIPQQVNSSAVSLTCNWTEHTSPEGFKYYYNSMTRESKWEKPEEYLLYEQQQQ
QQHQKLILLQQHQQKLAAQQLQSPPQAQTIPTMQSIQQHPQPLQGQTQMQMKQQELNYTQ
LQATGSIDPSRIQQGIQAAQERSWKN
Download sequence
Identical sequences I1IIW8
EG:BRADI4G08727.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]