SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G09770.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G09770.1
Domain Number 1 Region: 4-236
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.51e-40
Family Succinyl-CoA synthetase, beta-chain, N-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 259-395
Classification Level Classification E-value
Superfamily Succinyl-CoA synthetase domains 1.5e-19
Family Succinyl-CoA synthetase domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G09770.1   Gene: BRADI4G09770   Transcript: BRADI4G09770.1
Sequence length 423
Comment pep:novel chromosome:Brachy1.0:4:9178110:9181647:-1 gene:BRADI4G09770 transcript:BRADI4G09770.1
Sequence
MARKKIREYDSKRLLREHLKRLAAIDLQILSAQVTQSTDFEELVNQYPWLSTMKLVVKPD
MLFGKRGKSGLVALNLDIVQVKEFVKERLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLS
IVSERLGSTISFSECGGIEIEENWDKVKTVFLPTEKPMAPDAYAPLIAALPLEARGKISD
FIQGVFAVFQDLDFSFIEMNPFTMVNGEPYPLDMRGELDDTASFKNFKKWGNVEFPLPFG
RVLSSTESFIHDLDDKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGN
YAEYSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGIANFTDVAATFSGIIRALRE
KESKLKASRMHLYVRRGGPNYRTGLAKMRKLGAEIGVPIEVYGPEATMTGICKQAIECIM
AAA
Download sequence
Identical sequences I1IJA0
EG:BRADI4G09770.1 XP_003577226.1.954 15368.BRADI4G09770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]