SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G09817.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G09817.1
Domain Number 1 Region: 772-1089
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-72
Family Protein kinases, catalytic subunit 0.0000702
Further Details:      
 
Domain Number 2 Region: 346-698
Classification Level Classification E-value
Superfamily RNI-like 1.1e-61
Family 28-residue LRR 0.046
Further Details:      
 
Domain Number 3 Region: 81-427
Classification Level Classification E-value
Superfamily RNI-like 1.02e-60
Family Cyclin A/CDK2-associated p19, Skp2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G09817.1   Gene: BRADI4G09817   Transcript: BRADI4G09817.1
Sequence length 1106
Comment pep:novel chromosome:Brachy1.0:4:9233838:9237533:1 gene:BRADI4G09817 transcript:BRADI4G09817.1
Sequence
MAMAFPLMILALLLFLPATMFAAPSPQRNNATDLAALLAFKAQLSDPLGILGGNWTSGTS
FCHWVGVSCSRRRQRVTALMLPGILLQGSVSPYLGNLSFLHVLNLSNTNLTGSIPPDIGR
SSRLMVLDLGLNGLSGIIPRTIGNLTKLETLLLGYNDLSGQIPKDLQNLNNLRQIHLGIN
GLSGQIPEQFFNKTSLLNYLNFENNSLSGPIPPGIASCDMLESLNLRWNQLSGQVPPTIF
NMSRLQNMILSFNLYLTGPIPSNQSFSLPMLRNFRIGRNNFTGRIPPGLASCELLQELSL
SVNSFVDFIPTWLAKLSQLTFLSLAGNGLVGSIPGELSNLTMLNVLELSHANLSGEIPDE
LGELSQLTKLHLSSNQLTGSFPALVGNLTQLSLLAVDSNQLTGSVPANIGNLISLNILSI
GKNHLTGRLDFLSTLSNCKQLKYIGIEMCSFTGVIPAYIGNLSKKLTKLYAYNNHLTGIV
PTTISNLSSLTTVSFTGNQLSGTIPDSITLLENLELLFLSENSMVGPIPTQIGTLTRLLE
LSLEGNKFSGSIPNGVGNLSMLERTSFADNQLSSTIPGSLYHLSNLRVLLLYDNSLTGAL
HPDLGSMKAIDIVDISANNLVGSLPTSFGQHGLLSYLDLSHNALQGSIPDAFKGLLNLGL
LDLSFNNLSGTIPKYLANFTSLSSLNLSFNKFQGEIPDGGIFSDISAESLMGNARLCGAP
RLGFSPCLGDSHPTNRHLLRFVLPTVIITAGVVAIFLCLIFRKKNTKQPDVTTSIDMVNV
VSHKLVSYHDIVRATENFNEDNLLGVGSFGKVFKGQLDNSLVVAIKVLNMQVEQAVRSFD
AECQVLRMARHRNLIRILNSCSNLDFRALLLEYMPNGSLDAHLHTENVEPLGFIKRLDIM
LGVSEAMEYLHYHHCQVVLHCDLKPSNVLFDEDMTAHVADFGIAKLLLGDDKSMVSASMP
GTIGYMAPELAYMGKVSRKSDVFSFGIMLLEVFTGKRPTNAMFVGESNLRHRVSEAFPAR
LIDIVDDKLLLGEEISTRGFHDQTNIISSASPSTSCKSNFLVSTFELGLECSSKSPDERP
SMSEIIVRLKNIKKDYSASVMVTQVD
Download sequence
Identical sequences I1IJA5
EG:BRADI4G09817.1 XP_010237393.1.954 XP_014757976.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]