SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G11710.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G11710.1
Domain Number 1 Region: 71-259,363-530
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-123
Family Eukaryotic glutathione synthetase ATP-binding domain 0.00000146
Further Details:      
 
Domain Number 2 Region: 262-365
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.73e-35
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G11710.1   Gene: BRADI4G11710   Transcript: BRADI4G11710.1
Sequence length 533
Comment pep:novel chromosome:Brachy1.0:4:11583537:11589264:-1 gene:BRADI4G11710 transcript:BRADI4G11710.1
Sequence
MPSSCVSSPSSSHRHQCVGRLLAPPVPRASLAAVRPSLRRSFVSLRATSTEAAAGPDVAP
TGDAGKAAAVRAEMAEAAAVWCALHGLVVGDRADPRSGTVPGVGLVHAPFSLLPARFPSS
FWKQACELAPIFNELVDRVSLDGEFLQSSLSRTRQVDDFTARLLEIHAKMMAVNKKEDIR
LGLHRSDYMLDSETNSLLQIELNTISTSFPGLGSLVSKLHRSLLNRYGEVLGLDSERIPP
NWAASQFAEALYKAWAEYHHDSAVVMMVVQPEERNMYDQYWLVNHLKESHGVTAIRKTLA
QVEAEGQVLPDGTLVVDGRRVAVVYFRAGYAPNDYPSEVEWSGRLLIEESSAIKCPSISY
HLVGTKKIQQELAKPNVLERFVDNKTHIAKLRKCFAGLWSLDNDEIVKSAIEKPDLFVLK
PQREGGGNNLYGHDLRETLIRLQKEQGEALAAYILMQRIFPRASLTQLVQGGVCFEDLTI
SELGIFGAYLRNKDNIVINDQCGYLMRTKVSSSNEGGVAAGFAVLDSIILTDE
Download sequence
Identical sequences I1IJU8
EG:BRADI4G11710.1 15368.BRADI4G11710.1 XP_003575763.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]