SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G12227.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI4G12227.1
Domain Number - Region: 252-316
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00863
Family PHD domain 0.025
Further Details:      
 
Domain Number - Region: 331-482
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0837
Family DNA repair protein MutS, domain III 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G12227.1   Gene: BRADI4G12227   Transcript: BRADI4G12227.1
Sequence length 604
Comment pep:novel chromosome:Brachy1.0:4:12222131:12228958:1 gene:BRADI4G12227 transcript:BRADI4G12227.1
Sequence
MGTSSGANFHQQLPQGMPPPRHNGGAPSQQTYLSLASLEQVGSPDMQDPASNSGSPGHDS
ATESASSRETWPVEPSKSGGPATAAAAARIVDKDKEVATKDVAERQVIRRIPSTGRVTLR
EVARDRVDLVAEKMKVMPEELLDDIKTELRSILEGSGGPQHIEEFLYLQKLVQGRVDLTP
TMLLMAHHVQLEILVSIKTGIQAFLHPSVNIPLGHLAEVFLYRRCRNIACQSALPAEECR
CNICGNRNGFCNLCMCVICNKFDFEVNTCRWIGCDSCSHWTHTDCAIRDGQIGTGQKIKN
GIGHAEMLFRCQACQRTSELLGWVRDVFQQCAPGWDRDALLRELEYVRKIFRLSEDSKGR
NLFRRSADLIERLRSGTAQSMSPRALLQALQELEMDFPKISENEELGRLISPHEACNRIA
EVVQEAVRKMELVAEEKLRMVKKARHAVESCDRELEEKAREAREIQAERVRKQQQVVELE
SIVRLKSAEAEMFQLKANEARQEAEQLLSIAQAKSEKAEQDYASMYLKRRLEEAEAEKQY
IFEKIRLQETQRPVPPPPQASSSRAASGAAPGEQSQMMMLSKIQDLLKNVRSMPSGKSDG
QLSK
Download sequence
Identical sequences I1IK03
EG:BRADI4G12227.1 XP_003577311.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]