SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G13990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G13990.1
Domain Number 1 Region: 627-774
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.3e-39
Family Mannose-binding lectins 0.00016
Further Details:      
 
Domain Number 2 Region: 471-618
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.96e-38
Family Mannose-binding lectins 0.0002
Further Details:      
 
Domain Number 3 Region: 790-939
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.27e-32
Family Mannose-binding lectins 0.00036
Further Details:      
 
Domain Number 4 Region: 5-238
Classification Level Classification E-value
Superfamily RNI-like 2.2e-17
Family Cyclin A/CDK2-associated p19, Skp2 0.052
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G13990.1
Domain Number - Region: 426-462
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0176
Family Protein kinases, catalytic subunit 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G13990.1   Gene: BRADI4G13990   Transcript: BRADI4G13990.1
Sequence length 942
Comment pep:novel chromosome:Brachy1.0:4:14459066:14466558:1 gene:BRADI4G13990 transcript:BRADI4G13990.1
Sequence
MSVELPSQIQWLKSLMVLEIDAEVTAVPSDIVDLRGLLYLNLPSVAHLSTGIGRMTCLRT
LGVFDLSKNSTENVTSLGELTNLQDLRLTCSTSRSDNLERNLECLGSIIRKLSNLKRVTL
VPVVSSYVNAQDDARDSGMSISWHGISVVPLPLVLLQRLELSRCCCVFSSLPEWTKELTQ
LGILKISVRKLSNEDVVILKGLHALTALSLYIWTAPARRIVFDCEGFLVLKYFKFVCTTP
CVVFLSGAMANVRKLKLGFNADRVDQYSLVAAGLEGLTNLNEISTKIGGAGVDESGRRFA
ESALTDALSKHRSISIIVNVQWVDWNFCGDKEAQKEKYKEAQNGFREKCETDSGGSGDIH
ENLRENMSHHILSPLDIVSRLLEEIRHSVSEGSKIGGGNGQAFKIHKSWMKRIEFTPMYA
SPQEDCRQVKRCIELVLRCMDADKNKRPTVKDIVRELKQTETASPWVQAKFAKIGQWGGI
GGGPRDIEMAPHRLKSLTIGSGKVIYSLEFSYDDHHEKNHITGPWGGHGPEGHGNKFRIV
LQPTEFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVG
FFARAGWYLDAFGIYVKPMQETEEAGLAKIGPWGGNGGQVRDLKMPPQRLESVTICSGTV
LNSLTFIYHGHDGKKHTAGPWGASTGNPDQTDTILLCSSEFLTGVRGTTGPFDPASSDVI
VTSLTLITNTHSYGPFGQGRGTSFQIPLWGKGSIVGFFGCSESYINAIGVYVNPYLEAMQ
KELVSSREPRLTKIGPWGGNGDKGNVRYINAKMEPQHLESVTVSFGSVINSLSFSYIDFK
GVKHNVGPWGTPSGNSYKIVLESSEVLQGVSGTVGSSDGTSSNLVTSLTFATDQARAYGP
FGAGGGTPFSAAAAAGNDGPVVAFFGRAGLCLEALGVYVHRY
Download sequence
Identical sequences I1IKH0
15368.BRADI4G13990.1 EG:BRADI4G13990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]