SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G14000.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G14000.1
Domain Number 1 Region: 259-559
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-76
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 23-185
Classification Level Classification E-value
Superfamily L domain-like 1.46e-34
Family Polygalacturonase inhibiting protein PGIP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G14000.1   Gene: BRADI4G14000   Transcript: BRADI4G14000.1
Sequence length 609
Comment pep:novel chromosome:Brachy1.0:4:14471572:14476072:1 gene:BRADI4G14000 transcript:BRADI4G14000.1
Sequence
MKVLAFGLVLLGCLQPFAAIDLQVIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCN
QDGNVIGIILSSSGLSGVLSPSIAKLTALEQLFLDDNSITGRIPQELGNLSKLMTLKLGR
NHLNGSIPETFGLLSELQNLDLSQNLLSGNIPSSLSNLSLLNDINLANNNLTGEIPEQLL
QVSQYNYTGNHLNCGQNLISCEGGTTKTGGSRKSTLKVILGSIGGAVTLLVVVVLFVLWW
QRMRHRPEIYIDVAGQHDHSLGFGQIKRLSWRELQIATNNFSEQSVLGKGGFGKVYKGVL
PGPDGKKVAVKRLFEVESPEGEMAFLREIELISIAVHKNILRLIGFCTTPTERLLVYPFM
ENLSVASRLRDIKQNEPTLDWPTRMRIALGAARGLEYLHEHCNPKIIHRDVKAANVLLDG
NLEAVIGDFGLAKMMDMGRNTVTTAVRGTMGHIAPEYFKTGRPSVKTDIFGYGVMLLEIV
TGERAIFPDFLEGAGEVMLIDQVKLLMQEGRLEEILDRNMDYVYDFQELANIIQIALLCT
HMDPDQRPAMSEVVHMLEGNTVPTDRWEEWQIAELTRRQQYENRQHHNLFSFSEESLNIH
EAIELSGGR
Download sequence
Identical sequences I1IKH1
EG:BRADI4G14000.1 15368.BRADI4G14000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]