SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G14220.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G14220.1
Domain Number 1 Region: 331-405
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000323
Family Protein kinases, catalytic subunit 0.0044
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G14220.1
Domain Number - Region: 405-481
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000295
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G14220.1   Gene: BRADI4G14220   Transcript: BRADI4G14220.1
Sequence length 498
Comment pep:novel chromosome:Brachy1.0:4:14695407:14699654:-1 gene:BRADI4G14220 transcript:BRADI4G14220.1
Sequence
MILLALLIHGLTLAAGTYPIALTCNTSRGNYTAMSTYHTNLELLAAALPKNASFTSTLYA
KSSVGAAPDTVYGLTHCRGDTTNTSTCSECATAAFWNAQELCTFNKDTTIFYDICIVRFA
DWDFSGAANHAVLWRNPRDIEEPMLPGWDPDNSESVSIIINMIKVLLQGTAKQAAYNSPM
RYATGHMDASSTFPPLYSLAQCTPDLPPSECWACFQEINNQATEFFNGIRGGRVLAVPCN
LRYETSKFYQGNPMWQISLPAAADPSQKHKRRKIKVLIIATVVPLLASTICFIFCFGLIR
RKMKGKVSLHDKPNINLHEEELVWGLEGANSEFTFFDFSQVSDATSAFSDENKLGQGGFG
PVYKGQFPDGREVAIKRLASHSGQGFMEFKNEVQLIAKLQHTNLAWKLWKEERWLEFVDA
AIVPELHASEAMRCINIALLCVQENAADRPTTSSVVAMLSSESVTLPEPNHPAYFHVRVT
NEEPSSGNDVTVSVLDGR
Download sequence
Identical sequences I1IKK2
15368.BRADI4G14220.1 EG:BRADI4G14220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]