SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G15270.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G15270.1
Domain Number 1 Region: 559-669
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.46e-17
Family Protein kinases, catalytic subunit 0.0049
Further Details:      
 
Domain Number 2 Region: 66-156,188-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000838
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G15270.1   Gene: BRADI4G15270   Transcript: BRADI4G15270.1
Sequence length 709
Comment pep:novel chromosome:Brachy1.0:4:15942685:15949655:1 gene:BRADI4G15270 transcript:BRADI4G15270.1
Sequence
MDRSALACSVTALILVIFLPSRTATDDQLVPGKPLSPGAAIVSGDGAFALGFFNPSNSSA
TTPARLYLGIWYNGIPELTVVWVANRETPSTNSSVPTLSLTNTSSLVLSDGSRDVLWTTA
DVAAAPATAFMPKFKPNPLAKISGSAPGQSFDHPTDTFLPGMKIRMRHRTRAGERLVSWK
APGDPSPGRFSLGCDPATSLQVFLWDGARPVARTSPWNGYLVKTESSRRYQQPPADANNA
SASADDVVVYVAVVDNDEEIYFTYTLSEGAGRTRYVVTYSGQYQLQSWSVASSAWAALAN
WPSAECSRYGHCGPYGYCDETAAPSPTCVCLQGFEPVAGAQEWENGEFSAGCRRKEALPA
AGCSDGGFMALPDMKLPDGFAVVPGNRSRNCSCVAYAANLQGSGSSPRGDLTWCLVWAGE
LVDAGKIWANERSTTTEKNTWNLGTNLTMNKDGNKQDNSQGGRRTKGTAVKIALPVLGST
FAILTCVFLAWLKLRGTKNREKRKQKKITLAGMSISYELGEGKPSHDHEFPFVRFEEIAI
ATHNSLKRVYLDEEALEKFTSGYMVPEYAMEGVFSTKSDIYSFGVLLLEVVTGIRRSSST
MGFPNLIIYAWNMWREGKTKELVDSSINDTSSPDEVLLCIHLALLCVQENPDDRPIMSAI
VFILENGSTALPAPNRLAYFGRRSAELEQIGVDIQNSVNSVTLTEIKGR
Download sequence
Identical sequences I1IKV2
EG:BRADI4G15270.1 15368.BRADI4G15270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]