SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G16350.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G16350.1
Domain Number 1 Region: 345-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-52
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G16350.1
Domain Number - Region: 195-241
Classification Level Classification E-value
Superfamily LysM domain 0.00119
Family LysM domain 0.008
Further Details:      
 
Domain Number - Region: 253-261
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 266-331
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 0.0802
Family Molybdenum cofactor-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G16350.1   Gene: BRADI4G16350   Transcript: BRADI4G16350.1
Sequence length 676
Comment pep:novel chromosome:Brachy1.0:4:17089499:17091732:1 gene:BRADI4G16350 transcript:BRADI4G16350.1
Sequence
MAPSRATAALLFSAAVFVLLSGARSQQPYGTQIGDCHNKHNDTGMLGYFCNGAPSCQSYL
TFRARPPYSDPASIAALLGANATNLAAANSASPSSSSSFAPGTKVLVPVPCACTGRGRGH
YQSNVTSYVAVPGDTLLIIAKGTFQGLTTCQAVQEQSLGGKPPESLLAGQRLPVVPLRCA
CPSAAQAAAGTRFLVSYLVDEFDEVRAVAARFGVDAAGIAAANGLKSDGTIFPFTTLLIP
VKSPPDISQLRSPPPPPPPPPAASVPAAEKRSNHAGVYIGVGVAVAAVAVIASVGAVLAR
KARKRARAGAAVATTGKGTGKASHGTTSAGEVSVTISEAFSSLSDIKSSLKVYTYEELTA
ATDDFSAARRIGGSVYRATFGADTAAVEVVAGRDASKEVELMSRMNHFNLVRLTGVCHHR
GRWYLVSEYAAHGTLRDRLLLGATEAPAALSWAQRVQVALDAAEGLRYLHEYARPPCVHM
DVRSGSVLLDAALRGKVCNFGCARAIRGGAGEAGPPREFTMTSSIGGARGYVAPEYLEHG
VVSPKADVYSLGVVLLELVTGKGVDELDGSRGDPLAGLNALTTGDREEEGDGAALEKLEE
FVDPAMAAGSCPRDAVVMMVRLIERCLRRDAAARPSMGEVAQYLLKLSGISGDSWRSSSE
YLRSSGSETASQRLAR
Download sequence
Identical sequences I1IL35
15368.BRADI4G16350.1 EG:BRADI4G16350.1 XP_003575961.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]