SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G20800.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI4G20800.1
Domain Number - Region: 42-88
Classification Level Classification E-value
Superfamily Tim10-like 0.0562
Family Tim10/DDP 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G20800.1   Gene: BRADI4G20800   Transcript: BRADI4G20800.1
Sequence length 148
Comment pep:novel chromosome:Brachy1.0:4:23925834:23929393:1 gene:BRADI4G20800 transcript:BRADI4G20800.1
Sequence
MDHVGSMEERIVTERIRRKLEEVNAAAQQHLVGVQDHVNFTMQQAYFKCAYECFDRRQSQ
EGINNCVENCSVPVLSANNVVETEMAKFQERLNRSLMVCQDKFEAAKLQKMKTDATQELE
SCVHRSIDDSIRVLPHVVDQIKSTLNMK
Download sequence
Identical sequences I1IM57
EG:BRADI4G20800.1 15368.BRADI4G20800.1 XP_010237783.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]