SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G21820.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G21820.1
Domain Number 1 Region: 193-411
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.12e-62
Family BC ATP-binding domain-like 0.000000389
Further Details:      
 
Domain Number 2 Region: 419-516
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.94e-30
Family BC C-terminal domain-like 0.00015
Further Details:      
 
Domain Number 3 Region: 89-192
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.87e-29
Family BC N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G21820.1   Gene: BRADI4G21820   Transcript: BRADI4G21820.1
Sequence length 523
Comment pep:novel chromosome:Brachy1.0:4:25651937:25656983:1 gene:BRADI4G21820 transcript:BRADI4G21820.1
Sequence
MAFAAYGVRGPLKLAVGHGPFALANNHLCRGWRPPSSYAVSRASSANISSNAVRHMVRHS
HLVAPSSERRRSNTKASAVDGSIVAEERITVLVIGGGGREHALCYALNRSPSCESVLCAP
GNVGIAQSGDATCVSDLDISCSDDVISFCHKRRVGMVVVGPEAPLVAGLANDLVKAGIPT
FGPSSEAAALEGSKDFMKKLCDKYNIPTAKYRTFMDPVEAKQYVNDQGAPIVVKADGLAA
GKGVVVAMTLDEAFEAIDCMLVQGSFGSAGSQVIIEEFLEGEEASFFALVDGENALQLES
AQDHKRVGDGDVGPNTGGMGAYSPAPIVTEQLKRMVMESIIIPTVKGMAAEGCKFVGVLY
AGLMIEKKSGLPKLIEYNVRFGDPECQVLMMRLESDLAQVLLSACKGELGQVSLTWSPEI
AMVVVMASEGYPGSYKKGTIIKNISNAEQVSPAVKIFHAGTALDGDGNLVAVGGRVLGVT
AKGKDIEEARERAYAAADVIDWPEGFFRHDIGWRALKHKQIAN
Download sequence
Identical sequences I1IME6
15368.BRADI4G21820.1 XP_003577683.1.954 EG:BRADI4G21820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]