SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G21980.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G21980.1
Domain Number 1 Region: 363-671
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-67
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 54-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-57
Family Protein kinases, catalytic subunit 0.0005
Further Details:      
 
Domain Number 3 Region: 830-1117
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-55
Family WD40-repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 680-813
Classification Level Classification E-value
Superfamily PapD-like 0.000000000000133
Family MSP-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G21980.1   Gene: BRADI4G21980   Transcript: BRADI4G21980.1
Sequence length 1143
Comment pep:novel chromosome:Brachy1.0:4:25886559:25894512:1 gene:BRADI4G21980 transcript:BRADI4G21980.1
Sequence
MGISKVTDPASKVLLAASLALWHTCRRLLAIPFMNCYAVDPRQVRLHGPVPALGINSSGE
ETAVKVLHMTGVDDSEFQKEFRNLKSLRHDNIVELVGFCNEAEEVVAEFEGNQVVALKMH
TALCLEYVSNGSLQKHISDENTGLNWHIRYKIIKGICVGLKYLHEGLEFSVWHLDLKPDN
ILLDQNMEPKIADFGLSRLLGDEKTRKTMSAVGTCGYWPPEYLNHQIITKEFDIFSLGVI
ITKIMTGREGYTSIADMRPGKFVKHVHNNWRNKLCKILRPASLEVYCNQVKRCIEIALEC
LKPNRQERPTIQYIVSNLEETETVIGDISLHIEQFNNDGESTLHSESNVTSGHSSGGGEA
SSSTYFDTPTAKAVPFQLLESMTDGFSEERIIGKGEFTRVYKGVYENGQVIAVKRYHSSR
RLNDNEFENEIQYLMKVHHPNIIQLVGYCMHTEHQLIEYEGKMVFAEIQNKVLCLEYCSN
GSLDQHLSDISYGLDWLTRYRIIKGTCEGLRQLHERSSPIIHMDLNPSNIFLGECMVPKI
GDFALARVLEDEYSIQTIRMIGTRGYMPPEFIDKQVISIKSDIYSLGVVIIEIMTGKKYH
AYFELSIQELIENVHENWRKRLRATFDDTSGEGYCQQVKKCIKLALSCVEPERLKRPSIG
EIIDMLNETETFIHELTLKDKSELLDVHPVELYFPFEPKKATSCSLRLNNKGSDRVAFMV
MAKTQKMYSTKLPFCSVVPPGCSYTIAVTIRKQNQQLPSAISEFFTVQSVAVGDHDLKHV
DEDSASVVYGNFFKKAEEMNSDELQEMTLPVCWDLPAEGTESELFNCEVDHACLIWTWIH
EQIIATLDSQQVSSVEVHPSQPWIMTTHHGGSLRVWDYQTMATLQSFQVTDEPVHAAKFI
EREKWIIAGDGNGCIHVYSYEEKEPTSFDAHDSGITSLAVHPTQTVVLSFSHDDHLIKLW
DWEKDWECTRTFQGHTNRVTQITFNPNGADSFTSVSRDGKVKIWSVHSDGSSPITFDGDD
QGLLCVDYFTRRNRQHLITGCMDGTAKIWDLEMDILEGCVHKLEGHEGRVTAVNLHPELP
LLITGSLDGTVRLWDSTTYKLENIIGFNLGAVYGFGFIKGLRRLPNNEDVLLCVGWLSGA
TKE
Download sequence
Identical sequences I1IMG5
EG:BRADI4G21980.1 15368.BRADI4G21980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]