SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G24430.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G24430.1
Domain Number 1 Region: 727-1008
Classification Level Classification E-value
Superfamily L domain-like 1.39e-53
Family Polygalacturonase inhibiting protein PGIP 0.0016
Further Details:      
 
Domain Number 2 Region: 444-716
Classification Level Classification E-value
Superfamily L domain-like 1.62e-50
Family Polygalacturonase inhibiting protein PGIP 0.00062
Further Details:      
 
Domain Number 3 Region: 1062-1284
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-45
Family Protein kinases, catalytic subunit 0.0006
Further Details:      
 
Domain Number 4 Region: 2-264
Classification Level Classification E-value
Superfamily L domain-like 5.78e-39
Family Polygalacturonase inhibiting protein PGIP 0.0068
Further Details:      
 
Domain Number 5 Region: 318-405
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000351
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G24430.1   Gene: BRADI4G24430   Transcript: BRADI4G24430.1
Sequence length 1319
Comment pep:novel chromosome:Brachy1.0:4:29566851:29574440:1 gene:BRADI4G24430 transcript:BRADI4G24430.1
Sequence
MSGNRLEGHIPASLGNLSVNLQILYLGHNELSGNFPARLAPLPNMSSLGLERNHFMGVLP
EWIGNLKNIQSMQLQDNKFTGFVPESISNLSLLGLIYLDNKFRGHLPTSLGNLRMLQTFS
IFNNGFTGGVPTDIFRIPTLYDIDLSFNNLVGQLPTDIGTAKQLVNLALSSNYKLSGDVP
NTLGNCESLENILLGSNIFRGLKVLNFSNNNLTGPIPAYLGNLKLLEKLDLSFNHLEGEV
PKNGIFSNATSIKIDANHGLSGGIQELHLLACSVMPSNSSRHKLTFVLKLVIPVVSMVSL
AMVIVLLLFWGRKQKKKSLSLPSYGREFPEDSFIDLARATDGFSTAKMIGRETYGSVYEG
KLFPDGNYVAIKVFNLETTGSQKASLRNLSSIRTEPFVDEFHSVCGDGLDFRKNKVAKQK
SFDYNQGQETQVAENHISSLFGNETDMLSLLEFKNAISADPQQALMSWNESTHICNWEGV
RCRMKNPHRVTSLDLEHQASPIPPSLGRLRRLRYLFLSNNTLQGGIPSFSNCSSLKVLLL
NGNHLAGQIPIGWPSKLEDMNLSANNLTGILPASLANLTMLNDFRCLFNNIKGVIPNEFA
KFRRLHIFYVGINRLSGRFPQAMLNLSTLVDLSLTQNSFTGEVPSDIGNYLPKLQRLFLA
SNFFQWHIPPSLVNASKLSQIDISRNNFTGVMPDSIGKLSKLYWLNLELNKLEAHENQDW
EFMHSLASCSHLRVFSLNGNVFKGHVPSSLGNLSVKLETLNLGANKLSWSFPFGIENFLN
LIHLTLGINQLTGVVPGWIGSLKKLQSIDLSDNNFTGFIPTSLSNLSLLGNLYLSHNNSD
GPIPPSLGILQMLQAFYASNNNLHGRIPKEIFIIQTIIAIDLSFNNLDRVPVDFGNARQL
LYLSLSSNKLSGDIPNTLGNVESLQYIMLDSNIFSGSIPTSLVNIRGLKFLNFYNNNLSG
SIPMSLGNLQLLEQLDLSFNHLEGEVPTNGIFKNVTAMWLGENQGLCGGILELQLQACSI
MHSNSTKHKLFVVLKVVIPMVFMVSLAMVILILLSRGKKKTKSMILPSFHREFPKVSFLD
IVRATKGFSPSNIIGRGRYGCVYEGKLFQDGNFVAIKVFNMETRGSTKSFITECNALRGA
RHRNLVSIVTACSSIDSSGNDVKALVYKLMPRGDLHRVLYSTQDYKESSGLIHMIVPQRL
SIVVDVTDALEYLHHNNQGTIVHCDMKPKNILLDENMTAHVGDFGLARFKVDSAVSPSDD
LYLTSSVAINGTIGYIAPGMSNTGIKLLLACEIQSVQQVVMFRLLAMSIASELLYLKYS
Download sequence
Identical sequences I1IN55
15368.BRADI4G24430.1 EG:BRADI4G24430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]