SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G26260.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G26260.1
Domain Number 1 Region: 21-76
Classification Level Classification E-value
Superfamily Tim10-like 1.83e-16
Family Tim10/DDP 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G26260.1   Gene: BRADI4G26260   Transcript: BRADI4G26260.1
Sequence length 76
Comment pep:novel chromosome:Brachy1.0:4:31538435:31540801:-1 gene:BRADI4G26260 transcript:BRADI4G26260.1
Sequence
MDASALNNPRLQALLEEEKNKAMANEVIAKLTDTCWDKCITGSIGSSFSNSEASCLSNCA
KRFIEVKMVTMGRFQQ
Download sequence
Identical sequences I1INQ7
EG:BRADI4G26260.1 XP_003577870.1.954 15368.BRADI4G26260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]