SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G26450.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G26450.1
Domain Number 1 Region: 550-848
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-73
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 68-161,205-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.02e-18
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G26450.1
Domain Number - Region: 389-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Anti-platelet protein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G26450.1   Gene: BRADI4G26450   Transcript: BRADI4G26450.1
Sequence length 863
Comment pep:novel chromosome:Brachy1.0:4:31638367:31641257:1 gene:BRADI4G26450 transcript:BRADI4G26450.1
Sequence
MAAKASSCVLQLLLVLLLVVVVLAGQAAARDSLPRGGSMAVEDHAADVLVSADGAFACGF
YAVSPTVFTFSVWFARAADRAVVWSAVSPTRRLFVHSQGSRISLDKRRGALTLTDYDGEL
VWNSSTAADLGSAARLRDSGNLVVEDEKGKVLWQSFDHPTDTLLPTQRLIGSGGGGGFGQ
GLVSSGSGRAPLAAGHYGFRFSDYAMLSLVYDDGQVSSIYWPNPYFSYWQNSRKIYNFTR
AADLDTAGHFLSSDNATFDAADLGSPAAGEGVGRRLTLDADGNLRLYSLQQQDQQEAASS
FSGSGGAMTWAVTWMAFGNPCNIHGVCGANAVCLYSPAPACVCAPGHERADRSDWTRGCR
RLFSNSSIASDRQIKYVELPHTDFWGFDLNNSEYLSLDACQEQCSGEPSCAVFQYKQGKG
ECYPKSYMFNGRTFPGLPGTAYLKVPADFDVPEVNVHQWRTNGVGAGLAIEENIARCNDG
AILPEVLLNVSSKSTSGNPGKSLWFYFYGFLSAFFVIEVFVIAFGCWLFSKNGVLRPSEL
LAVEEGYKIITSHFRAYSYSELERATKKFRCEIGHGGSGTVYKGVLDDERTVAVKVLQDV
SQSEEVFQAELSAIGRIYHMNLVRMWGFCLEGAHRILVYEYVDNGSLANVLFQNAGESGK
FLGWKQRFNIALGVAKGLAYLHNECLEWIIHCDMKPENILLDGEMEPKITDFGLAKLLNR
DGSDSGMSRIRGTRGYMAPEWVSSLPITDKVDVYSYGVVLLELIKGRRVSDWVVDGKEGL
ETDVRTVVKMIVDRSKSGDEGCIMYLMDEQLDGEFNHVQAKMMAQLAVSCLEEDRNNRPG
MKHVVQMLISADDESRDHQYPEI
Download sequence
Identical sequences I1INT0
15368.BRADI4G26450.1 XP_003576351.1.954 EG:BRADI4G26450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]