SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G26460.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G26460.1
Domain Number 1 Region: 533-828
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-71
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 71-163,190-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-25
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Domain Number 3 Region: 373-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000667
Family Anti-platelet protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G26460.1   Gene: BRADI4G26460   Transcript: BRADI4G26460.1
Sequence length 836
Comment pep:novel chromosome:Brachy1.0:4:31641402:31644212:-1 gene:BRADI4G26460 transcript:BRADI4G26460.1
Sequence
MDTTPPFFLPTLLLALLALTDICAAAAAPRGDILPLKSSLTVEEHDTDAGILRSPDGTFA
CGFHAMYTGAFTFSIWYHHSNSLNETAVVWSANRGRPVLSRRSLVTLRGDGTMVVADHDG
EVVWQTQGGLPNVKHAQLLDTGNLVLRNTTGDIVWQSFDSPTDTFLPTQRIPAMAKLTST
AGGGQLHLPGHYTFRFSDQSILSLFYDDANVSDIYWPDPDYEYYENNRNLYNSTRMGSLD
DSGEFFASDFASHQPLVASDNGLGIKRRLTLDPDGNLRMYSLSSSNGSDTDSDSTTWTVS
WVAVSQPCMIHGLCGPYGICHYSPAPTCSCPPGYAMRNPGNWTQGCKLIVDTIGCGKGEE
DVQFLLLPDTDFWGSDQRRIGKVSLETCRKACLSECTCKGFQYQPGNGTCYPKSFLFNGR
SFPTPTVRTMYIKLPASVNISSTPIPQSNMLSSESHALKCDDPTSAKTVEPVRDVVERED
DDAGEEPKWVYFYGFIAALFVIEVSFFSFAWFFVLRREFRSSQLWAAEEGYRVMTSHFRM
YSYRELVKATEKFKYELGWGGSGVAYKGTLDDERAVVVKMLENVTRNKEEFQDELRVIGR
INHMNLARIWGFCSERSHRMLVLEYVENGSLANILFSNKILLEWDQRFNIALGVAKGLAY
LHHECLEWIIHCNLKPENILLDQDLQPKITDFGFAKLLSRSGSNQNVSQARGTLGYIAPE
WVSGLPITAKVDVYSYGVVLLELVLGTRIVDSIVGSEEDVHGVLNKFVQMLTYRLDGEEL
LWLDEFVDFRLGGKFNCLQAKELIRITLSCLEGNRKKRPTMESIVEILLSIDEAEI
Download sequence
Identical sequences I1INT1
EG:BRADI4G26460.1 15368.BRADI4G26460.1 XP_003576352.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]