SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G26480.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G26480.2
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 8.17e-26
Family Ribosomal proteins L24p and L21e 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G26480.2   Gene: BRADI4G26480   Transcript: BRADI4G26480.2
Sequence length 138
Comment pep:novel chromosome:Brachy1.0:4:31649921:31652200:-1 gene:BRADI4G26480 transcript:BRADI4G26480.2
Sequence
MIIRGKDKGESGLIKRVIRSQNRVIVEGKNLVKKHIKQGEGHTGGIFSIEAPLHVSNVQV
IDPVTGKPCKTGYKYLEDGTKVRVSRGMYASGAVIPRPEILKERKKPRPTSPGPKDTPFE
HVLEKTYDAKAGLGMPDL
Download sequence
Identical sequences I1INT4
EG:BRADI4G26480.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]