SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G26620.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G26620.1
Domain Number 1 Region: 24-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-66
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G26620.1
Domain Number - Region: 562-688
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.0214
Family Neurotransmitter-gated ion-channel transmembrane pore 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G26620.1   Gene: BRADI4G26620   Transcript: BRADI4G26620.1
Sequence length 695
Comment pep:novel chromosome:Brachy1.0:4:31733008:31737319:1 gene:BRADI4G26620 transcript:BRADI4G26620.1
Sequence
MADHARELEALERILSDDAGAEPTRLAYGLMKSITNDFSPSREIGSGGFGVVYLGILRKG
TVAVKKLTMSPTFSDDLFLDEVRCLMRTKHKNIVRFLGYCSDTQGELIEHNGRKIMAEVR
QRLLCFEYVPNGSLQRYLKEKCHGNGWKIRYQFMKGICQGLHYLHKERINHLDLKPENVL
LDAYMEPKISDFGLSRWFDEGQSRIVTINTPGTRGYIAPEIIDKGEISFKSDIFSLGIII
IKLLTGSDHHEFENWHESIDVEGPQVKSCIEIARTCVEADQHNRPCISEIIDKLNEMENA
EESRDGTGSSMVSPSSSKEVIPPSTMCRMDKQDCEYAKMDTCLADGMGHSKHDSGVSKDT
KTVQLLGQRRVEDNDGSNFLVHDKDLYNGPKMMTNQKARSGDEKGPNGGSGPSNQGKMSG
MLLTPPAMMRPNMMPGVGMLQAAAAAGNPIALKNIQMMQQQMMMNNGGTGYPRMGYGMQG
MYPMPPNMMQHTAPTKVDPVKFKNPEPEGGGGSESHDLDNEESKDSGSKAHKSGGAQPNN
IKGQEKKGTGTGGLATGGLMGGMLPPQLLPPRPLPPQQQQAMLRPTMMGSSGGFPGMGQM
GYRPHMENGVHGMLPPPPPPPTGFYQSGMPPYDREREILHIAAAAGNSMAQLQHRALAQQ
QQQQHMAFYLFLFMFLFLFTIVIIIIVIFTFKARR
Download sequence
Identical sequences I1INV2
15368.BRADI4G26620.1 EG:BRADI4G26620.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]