SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G26860.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G26860.1
Domain Number 1 Region: 192-297
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.96e-24
Family Staphylococcal nuclease 0.0052
Further Details:      
 
Domain Number 2 Region: 135-182
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000575
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G26860.1   Gene: BRADI4G26860   Transcript: BRADI4G26860.1
Sequence length 311
Comment pep:novel chromosome:Brachy1.0:4:31888541:31891734:-1 gene:BRADI4G26860 transcript:BRADI4G26860.1
Sequence
MGNILKRCFSGGEEEDGQYPYYHPASRPHYQPHSPHEQEEGHGVAALAQDLLNFESTASM
VPEGLRQHVTASKKAQVKWYQNMLEAYKNTTPPPRTPAEAAQLVATALDWIQRADLEVNN
KNIGDGDGFTAYVATTDPRESAIVPLEVHEMVIERNQARNRRDYQSADALQNRLNEAGYK
ILVCSDEEILARKYRIRMRGIDAPELKMAYGKESRNALVKLIGGKRTIIHVYGLDQFERY
VGDIYCDNVFIQEQMLKNGHAWYFKKYDKRGEFAKWEREARAAYRGLFVLENPEKPWDWR
KKQRNGGIPVC
Download sequence
Identical sequences I1INY5
15368.BRADI4G26860.1 EG:BRADI4G26860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]