SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G27440.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G27440.1
Domain Number 1 Region: 890-1181
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-74
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 84-448
Classification Level Classification E-value
Superfamily RNI-like 6.67e-64
Family 28-residue LRR 0.055
Further Details:      
 
Domain Number 3 Region: 505-621,665-803
Classification Level Classification E-value
Superfamily L domain-like 3.4e-58
Family Polygalacturonase inhibiting protein PGIP 0.00075
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G27440.1
Domain Number - Region: 443-510
Classification Level Classification E-value
Superfamily L domain-like 0.00126
Family Polygalacturonase inhibiting protein PGIP 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G27440.1   Gene: BRADI4G27440   Transcript: BRADI4G27440.1
Sequence length 1211
Comment pep:novel chromosome:Brachy1.0:4:32588207:32592030:-1 gene:BRADI4G27440 transcript:BRADI4G27440.1
Sequence
MAAAPTFTAAFFFLLVLLQVPAPAIASAEEAAALLAFRRVSVTADPRGALASWAPASTGA
NSTAPCSWAGVSCAPSTDGRVVAVNLSGMDLAGELRLGALLALPALQRLDLRGNAFYGNL
SHSASSSCALVEVDISSNAFNATVPPAFLASCGSLQTLNLSRNSLTGGGFPFAPSLASLD
LSRNRLADAGLLNYSFAGCHGLRYLNLSANLFTGRLPEQLASCSAVTTLDVSWNLMSGAL
PAVLMATAPANLTYLSIAGNNFTGDVSGYDFGRCANLTVLDWSYNGLSSTRLPPGLANCS
RLEALDMSGNKLLSGSIPTFFTGFTSLRRLALAGNEFAGPIPGELSQLCGRIVELDLSNN
GLVGALPASFAKCNSLEVLDLGGNQLSGDFVATVISTISSLRMLRLSFNNITGANPLPVL
AAGCPLLEVIDLGSNEFNGEIMPDLCSSLPSLRKLFLPNNYLNGTVPTLLGNCANLESID
LSFNFLVGQIPPEIITLPKLVDLVVWANGLSGKIPDILCSNGTTLETLVISYNNFTGIIP
PSITRCVNLIWVSLSGNRLTGSVPPGFAKLQKLAILQLNKNLLSGRVPAELGSCNNLIWL
DLNSNSFTGTIPSELAGQAELVPGGIASGKQFAFLRNEAGNICPGAGVLFEFFGIRPERL
AEFPAVHLCPSTRIYTGTMDYTFSKNGSMIFLDLSYNGLTGAIPGSLGNLMYLQVLNLGH
NELSGTIPEAFSSLKSIGALDLSNNQLSGGIPSGLGGLNFLADFDVSNNNLTGSIPSSGQ
LTTFPASRYDNNTALCGIPLPPCGHDPGRGNGGRASPDGRRKVIGASILVGVALSVLILL
LLLVTLCKLRKNQKTEEMRTEYIESLPTSGTTSWKLSGVPEPLSINVATFEKPLRKLTFA
HLLEATNGFSAETLVGSGGFGEVYKAKLKDGSVVAIKKLIHYTGQGDREFTAEMETIGKI
KHRNLVPLLGYCKIGDERLLVYEYMKHGSLDVVLHDNDKAIVKLDWAARKKIAIGSARGL
AFLHHSCIPHIIHRDMKSSNVLLDNNLDARVSDFGMARLMNALDTHLSVSTLAGTPGYVP
PEYYQSFRCTTKGDVYSYGVVLLELLSGKKPIDPNEFGDNNLVGWVKQMVKENRSSDIFD
PTLTDTKSGEAELYQYLKIASECLDDRPIRRPTMIQVMAMFKELQLDSDSDFLDGFSINS
STIDESAEKSS
Download sequence
Identical sequences I1IP60
15368.BRADI4G27440.1 XP_003577946.1.954 EG:BRADI4G27440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]