SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G28107.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G28107.1
Domain Number 1 Region: 650-930
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-71
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 68-344
Classification Level Classification E-value
Superfamily RNI-like 4e-56
Family 28-residue LRR 0.055
Further Details:      
 
Domain Number 3 Region: 281-585
Classification Level Classification E-value
Superfamily L domain-like 2.35e-51
Family Polygalacturonase inhibiting protein PGIP 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G28107.1   Gene: BRADI4G28107   Transcript: BRADI4G28107.1
Sequence length 950
Comment pep:novel chromosome:Brachy1.0:4:33462728:33465994:-1 gene:BRADI4G28107 transcript:BRADI4G28107.1
Sequence
MAALFLALLLLSLRTAAPYDAGSLLAAKRKLSDPAGALSGWKARSGGHSPCAWPHVACAV
NSTTDVAGLYLKNVSLSGVFPASLCSLRSLRHLDLSQNDIGGPLPVCLAALPALAYLDLS
GNNFSGHVPAAYGAGFRSLATLNLVENALSGAFPAFLANLTSLQELMLGYNDFTPSPLPE
NLGDLAGLRLLYLSRCYLKGRIPSSLGNLRNLVNLDMSVNGLSGEIPGSIGNLGSAVQIE
FYSNQLSGRIPEGLGRLKKLQFLDLSMNLLSGAMPEDAFAGPRLESVHIYQNNLSGRLPA
SLASAPRLNDLRLFGNQIEGPFPPEFGKNTPLQFLDMSDNRLSGPIPPTLCASGRLAEIM
LLNNKLEGSIPVELGQCWSLTRIRLLNNSLSGTVPPEFWALPNVRMLELRLNALSGTIDP
AIGGARNLSKLLLQDNRFTGALPAELGNLAILKELFVSGNNLSGPLPASLVELSELYTID
LSNNSLSGEIPRDIGRLKKLVQVRLSHNHLTGVIPPELGEIDGISVLDLSHNELSGGVPG
QLQKLRIGNLNLSYNKLTGPLPDLFTNGAWYNNSFLGNPGLCNRTCPSNGSSDAARRARI
QSVASILAVSAVILLIGFTWFGYKYSSYKRRAAEIDRENSRWVFTSFHKVEFDEKDIVNS
LDEKNVIGEGAAGKVYKAVVGRRSELALAVKKLWPSNTVSTKMDTFEAEVATLSKVRHRN
IVKLFCSMANSTCRLLIYEYMPNGSLGDFLHSAKAGILDWPTRFKIAVHAAEGLSYLHHD
CVPSILHRDVKSNNILLDADFGAKVADFGVAKAIVDGTATMSVVAGSCGYIAPEYAYTIH
VTEKSDVYSFGVVILELVTGKWPMASEIGEKDLVAWVRDTVEQNGVESVLDQKLDSLFKD
EMHKVLHIGLMCVNIVPNNRPPMRSVVKMLLDVEEENKRKARIEASLPSI
Download sequence
Identical sequences I1IPE1
EG:BRADI4G28107.1 XP_003576419.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]