SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G29070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G29070.1
Domain Number 1 Region: 182-284
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.52e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00032
Further Details:      
 
Domain Number 2 Region: 286-361,389-438
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.44e-28
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G29070.1   Gene: BRADI4G29070   Transcript: BRADI4G29070.1
Sequence length 444
Comment pep:novel chromosome:Brachy1.0:4:34506919:34509003:-1 gene:BRADI4G29070 transcript:BRADI4G29070.1
Sequence
MSSRIKVLWFFLSCGGVLLDIATGPESSTRRRFNVFDLADFEFLYSQIRSYGFDEFLLVC
HDAFVGSMFYDFGVILWHSGEVHVTERPSLLGDIIPGPKKPATLLFGPCEWSAMLRRTLP
RLSSVKDRVAGAAKHAVKGDEHFPSLHGHPAARVHAREAAEKQAGLAAAEEEKQRGGKAD
TVKEFQIYRWNPDSPGRPFLQSYSVDLATCGPMVLDVLQKIKSDHDSTLAFRRSCREGIC
GSCSMNIDGVNTVACLKPVDTDTSTATMITPLPHMFVVKDLVVDLTNFYQQYKSVEPWLK
TKQPAAEGREHVQSPGERRKLDGLYECILCACCSTACPSYWWNSEDFLGPAALLHAYRWV
SDRYEMYYHKWSESLINVWRDQLEWITTCSRDEYGEERIQALSEGWDKLYRCRMIKSCTA
TCPKSLDPAAAISALKTMHQLRKA
Download sequence
Identical sequences I1IPQ3
15368.BRADI4G29070.1 EG:BRADI4G29070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]