SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G29887.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G29887.1
Domain Number 1 Region: 684-1006
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.1e-68
Family DNA repair protein MutS, domain III 0.00017
Further Details:      
 
Domain Number 2 Region: 1024-1255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.92e-48
Family ABC transporter ATPase domain-like 0.0000132
Further Details:      
 
Domain Number 3 Region: 357-480
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.44e-32
Family DNA repair protein MutS, domain I 0.00095
Further Details:      
 
Domain Number 4 Region: 120-163
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000014
Family Tudor domain 0.0099
Further Details:      
 
Domain Number 5 Region: 479-603
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.000000288
Family DNA repair protein MutS, domain II 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G29887.1   Gene: BRADI4G29887   Transcript: BRADI4G29887.1
Sequence length 1318
Comment pep:novel chromosome:Brachy1.0:4:35566657:35578374:1 gene:BRADI4G29887 transcript:BRADI4G29887.1
Sequence
MASRRLSNGRSPLVRKQSQITSFFSTPSPSSSASKSAAKPTPSPSSTPKSDAKPSPSPSS
SAPKPAAKPSPSPLNPKARKPPLVVPSPSPPKSAPPAPQQQGQDEEKKEQNASAAPAGEA
VGRRLRVYWPLDDAWYEGRVDDYDEGSRRHRVKYDDGEDEEVDLRKEKFEWAAEEATPPP
ARKLRRLRRMSDTANAKSLAGLEDEEIGDSPEDGDWKKDAEEVELDDEEDEAVSSRKGKS
RNSLSMSASTPRSTSGLASTSSGSTVLKKRKKVDVGTLDCAKKFSFQLASTPEKVELKVP
MSCDGREKILENAHTVLTGELAERFGQRQAEKFKFLGDGRKDAKGRRPGHPAYDPRTLSL
PPQFLANLTGGQRQWWEFKSQHMDKVLFFKMGKFYELYEMDAHVGARELDLQYMKGDQPH
CGFPEKNLSVNLEKLAQKGYRVLVVEQTETPNQLELRRKETGTKDKVVRREICAMVTKGT
LTEGEFLLANPDPSYILSVAESYQHSSKKSQDGHTIGVCIVDVSTSKFVVGQFQDDAERH
VLCSILSEIRPVEIIKPAKMLSPETERALKNNTRDPLINDLLPSTEFWDAEKTIHEIEQY
YSSSDKLTTSQNTPGVQNNVGCLPALLSELIGAGDRAYALSALGGSLFYLRQVLLDKKLI
PCAEFEPLTCSGLLNNTRKHMIFDAAALENLEILENATGGLSGTLYAQLNHCVTGFGKRL
LKRWIVRPLYDSKAILQRQGAIAIFKGVGHECAIQFRKDLSRLPDMERLLARLFSSCDEN
GRSSKSVVLYEDVSKRLLQQFTSALRGCQQMFQACSSVRMLTGTEGSCLLNDLLSPGKGL
PDVSSILDHFRDAFDWSEADHNGRIIPHEGCDPEYDATCSAIEEIESSLKEYLKEQRELL
ADSSVKYVDVGKDTYLIEVSESLGGSVPRNYELQSTKKGFYRYWTPEVKELISELSKAAA
GKESILKGILQKLIHLFVEHHSKWRQLVSVVAEIDVLISLAIASDYFEGPTCRPTIRESY
GSDDTPTFYARNLGHPIIRSDSLGKGSFVPNDIKMGGPGNASFIVLTGPNMGGKSTLLRQ
VCLTIILAQIGANVPAENFEFSLVDRIFVRMGARDHIMAGQSTFLVELMETASVLSSATK
NSLVALDELGRGTSTSDGQAIAASVLEYLVHHVQCLGLFSTHYHRLAVEQQDIKVSLCHM
ACEVGMGEGGLEEVTFLYRLTAGSCPKSYGVNVARLAGIPASVLQRANQKSNEFEANYGK
QHFATKDKFVCALREDNFATIKDLFRVVKAGNHQEGQVASLSMLREIQKLARVQAIKG
Download sequence
Identical sequences I1IQ01
EG:BRADI4G29887.1 XP_003576514.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]