SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G32830.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G32830.1
Domain Number 1 Region: 397-685
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-76
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 292-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000437
Family EGF-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G32830.1
Domain Number - Region: 258-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0322
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G32830.1   Gene: BRADI4G32830   Transcript: BRADI4G32830.1
Sequence length 739
Comment pep:novel chromosome:Brachy1.0:4:38613378:38617900:-1 gene:BRADI4G32830 transcript:BRADI4G32830.1
Sequence
MKFEYPRLVHSAHLFLCLSSVCGIILLATAQAPAGPRPGPGCQAKCGDVDIPFPFGIGKE
CALDGFHLMCNDSKPFKGDFEVVNFNVPDGKIRVKTAISSQCYNTTTNVMHYSDASSIFT
DSVFWVSEKENKIIVIGCNTLAYMISSSYVIGCVSTCADKTPESLTCSGAGCCQADVPKD
IREYRALFNTDYNTTTYSGCAYMALMEEAALNFDPSFVTSGSTKFSDKNNGKVPVVLNWK
IQNITCDVATKNTSTYACVSSNSACLNSTNEPGYLCKCLDGYRGNPYITDGCQDIDECHD
ENADRCRFGLCENTPGNYTCSCYPGNYLMGGVCVPAASSFPEKTIAGTTVGLVIFVIAVA
CACLIRERRKLQNMKQNYFRQHGGLILFEEMKSKQGVTFKIFTEEELQQATNRFSEQQVL
GQGGHGTVYKGLLKSDVEVAVKRCTTIDEQQKKEFGREMLILSQINHKNVVKLLGCCLEV
QIPMLVYEFVPNGTLFDLIHGNHGGHISFDTRLAIAHESADALAYLHSSASTPIIHGDVK
SSNILLDSDHGAKVSDFGASILAPTDKSQFVTIVQGTCGYLDPEYMQTCLLTDKSDVYSF
GVVLLELLTGKKPFNFNPDAPEHEKSLSMMFMCAMKENKLEEVLDDQIKNEGNMEFLEEI
AELAKQCLDICGENRPSMKEVVEKLDRVRKVMQHPWAQQNPEETESLLGERSNMASSTGI
SAESFSIEIKTIMGMQSGR
Download sequence
Identical sequences I1IQZ0
15368.BRADI4G32830.1 XP_003576638.1.954 EG:BRADI4G32830.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]