SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G33610.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G33610.1
Domain Number 1 Region: 25-187,297-445
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-65
Family Protein kinases, catalytic subunit 0.000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G33610.1   Gene: BRADI4G33610   Transcript: BRADI4G33610.1
Sequence length 465
Comment pep:novel chromosome:Brachy1.0:4:39326808:39328502:1 gene:BRADI4G33610 transcript:BRADI4G33610.1
Sequence
MQPDESGSGGSGMPVDIDLGAVRAVRVLGRGAMGTVFLVADDADEPGVHALKVFDKRSPS
SSPRVVSREADAAGDAVRRARWEVSVLSRLAPQNHPHLPSLLGRAETPDLLAWATPYCPG
GDLNAVRHAQPDRVFSPAAVRFYAAELVSAIAGLHAAGIAYRDLKPENVLLRADGHVTLT
DFDLSRLLIVPSSSPSTSSTTSSSCSCSATPSPTTPKPRRRQYRHHLRRIFARSASALAA
PSSTPGQEEEPRNLAWFLNRTHGGAGNLTKKAKSARAASSLPSDREKHAGFCPASASAAA
TRSFSFVGTEEYVAPEVVRGDGHEFAVDWWALGVLVYEMAFGRTPFRGRSRRETFRNVLL
REPGFPADVRRRWPDLTGLVSRLLDKDPATRLGFSGGADEVRAHPFFARVAWDLLGEVSR
PPYIPSLDDHVVSAGEGFSVVDYFHKLHQPPPLPHESPESALQEF
Download sequence
Identical sequences I1IR80
EG:BRADI4G33610.1 15368.BRADI4G33610.1 XP_003576675.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]