SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G33910.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G33910.1
Domain Number 1 Region: 147-269,386-545
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 6.54e-102
Family Substrate-binding domain of HMG-CoA reductase 0.000000114
Further Details:      
 
Domain Number 2 Region: 272-388
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 2.62e-46
Family NAD-binding domain of HMG-CoA reductase 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G33910.1   Gene: BRADI4G33910   Transcript: BRADI4G33910.1
Sequence length 565
Comment pep:novel chromosome:Brachy1.0:4:39579452:39583041:1 gene:BRADI4G33910 transcript:BRADI4G33910.1
Sequence
MAVEVLRRVPAPRGGAVGAQRREERARVQAGDALPLPIRHTNLIFSALFAASLAYLMRRW
REKIRSSTPLHVVGLTEIFAICGLVASLIYLLSFFGIAFVQSVVSNSDDEEEDFLIASGA
GCSQAPPPPAPAPCALLGSPGAGPEKMPAEDEDIVAEVVAGKIPSYVLETRLGDCRRAAG
IRREALRRITGREIDGLPLDGFDYASILGQCCEMPVGYVQLPVGVAGPLVLDGRRLYVPM
ATTEGCLVASTNRGCKAIAESGGASSVVFRDGMTRAPVARFPSARRAAELKGFLENPANF
DTLSVVFNRSSRFARLQGVKCAMAGRNLYMRFTCSTGDAMGMNMVSKGVQNVLDYLQDDF
PDMDVVSISGNFCSDKKSAAVNWIEGRGKSVVCEAIIREEVVKKVLKTNVQSLVELNVIK
NLAGSAVAGALGGFNAHASNIVTAIFIATGQDPAQNVESSQCITMLEAVNDGRDLHISVT
MPSIEVGTVGGGTQLASQSACLDLLGVKGANRESPGSNARLLATVVAGAVLAGELSLISA
QAAGHLVQSHMKYNRSSKDMSKAAC
Download sequence
Identical sequences I1IRB9
15368.BRADI4G33910.1 XP_003578341.1.954 EG:BRADI4G33910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]