SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G35130.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G35130.1
Domain Number 1 Region: 49-153
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000231
Family 2Fe-2S ferredoxin-related 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G35130.1   Gene: BRADI4G35130   Transcript: BRADI4G35130.1
Sequence length 161
Comment pep:novel chromosome:Brachy1.0:4:40610925:40611922:-1 gene:BRADI4G35130 transcript:BRADI4G35130.1
Sequence
MAIAARALRRLPLHLSPSLARPFCAISPAAAAAPAPAAASAKVADRIVRVLAIDLDGGRR
EVVGLSGQTLLRALSNAGLIEPASHRLDDIDACSAECEVHIAQEWLEKLPPASYEERYVL
TRASRNRELNKHARLGCQVVLSQEHQGMVVALPEPKPWDIP
Download sequence
Identical sequences I1IRT7
XP_003578437.1.954 EG:BRADI4G35130.1 15368.BRADI4G35130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]