SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G36137.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G36137.1
Domain Number 1 Region: 57-370
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.93e-82
Family Protein kinases, catalytic subunit 0.0000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G36137.1   Gene: BRADI4G36137   Transcript: BRADI4G36137.1
Sequence length 406
Comment pep:novel chromosome:Brachy1.0:4:41409615:41414134:1 gene:BRADI4G36137 transcript:BRADI4G36137.1
Sequence
MGCLGWFKRRKPRSRRRGSSGPATTTTSAVSTSRSDDSGAVRPVSKSTTTTTGSSTVSQR
SITELYEERGHGQLRAFEFEELRAATNDFSRAQKLGEGGFGSVYKGYVRPLDAKGDRIAV
AVKRLNLRGLQGHKQWLAEVQFLGVLEHPNLVKLLGYCATDGERGAQRLLVYEYMPNKSL
EDHLFSRIYSPLSWNRRLQIILGAAEGLAYLHEGLELQVIYRDFKASNVLLDKDFQAKLS
DFGLAREGPTEGNTHVSTAVVGTHGYAAPDYIETGHLTAKSDVWSFGVVLYEILTGRRSL
DRNRPQGEQKLLEWVGQFGPDSRNFRMIMDPKLRGEYSSKAAREIAKLAQSCLVKNAKER
PAMSEVIEVLRRAVQVELAAPSPGPGDKPNSAGKGKRVDVAPPSRR
Download sequence
Identical sequences I1IS62
XP_003578499.1.954 EG:BRADI4G36137.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]