SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G36820.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI4G36820.1
Domain Number - Region: 25-180
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0333
Family NRPS condensation domain (amide synthase) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G36820.1   Gene: BRADI4G36820   Transcript: BRADI4G36820.1
Sequence length 435
Comment pep:novel chromosome:Brachy1.0:4:41975932:41977655:1 gene:BRADI4G36820 transcript:BRADI4G36820.1
Sequence
MEVKVLSSKLVKPAACNNGGATETEYIPLSIFDRVTFQMQMAIIYAFAPPAPSTAAIEKG
LALVLGQYRAFAGQLGESPDGSPAVILNDRGARLVEASVDADLVDMAPAKPTPELLKLHP
DLEGEQPLEEVVLLQLTRFRCGSLAVGFTSNHVVADGHATSNFLVAWGRATRGLPMGPPP
VHHYHGLFKPRSSPRVEHDHRRREYHLPSPNDVVGHHGDAADNIVIHKAHFTKDFIAGLR
ADASVGRGRPFSRFETILAHLWRAMTRARGLGPEESSAIRLSVDGRHRLGKPAEYFGNMV
LWAFPRSTVGDLLNRPLKHAAQVIHDEVARVDGAYFQSFVDFACSGAVQKEKLAPSAVLK
DAHCPDVEVDSWLTFPFYELDFGTGSPSYFMPSYFPTEGMLFLAPSYIGDGSVDAFVPVF
QHNLQAFKECCYSVE
Download sequence
Identical sequences I1ISE5
EG:BRADI4G36820.1 15368.BRADI4G36820.1 XP_003578556.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]