SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G37220.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G37220.1
Domain Number 1 Region: 511-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 68-162,194-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.94e-27
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G37220.1
Domain Number - Region: 369-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0118
Family Hairpin loop containing domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G37220.1   Gene: BRADI4G37220   Transcript: BRADI4G37220.1
Sequence length 844
Comment pep:novel chromosome:Brachy1.0:4:42404043:42407357:-1 gene:BRADI4G37220 transcript:BRADI4G37220.1
Sequence
MARAAGRVVVVAALAVVCFFFLSPRPCAGAGDELVAGELLAPGKPLVSDGGAFALGFFSP
SISTPDRQYLGIWYNSIPVNTVVWVANRETPITNGTSAPRLALDNDSSNLVLSDADGRAV
WTTGMASGSPPAALAVLTNAGNLVLRSANGTALWQSFDHPADTFLPGMKVWLNHRTHEGG
RLVSWSSPEDPSPGRFSYGMDPDTALQLLVWDGTRPHWRSPVWNGYTVQASYVSGTGTVV
YTAIVDTEDEISNTFTVSPGAAPTRFVLTSSGQFQLLGWNGSASAWATVGSWPSSGCSRY
GYCGPYGYCDVAAAACRCLDGFEPAWATGGDFSKGCRRKEPLPPCGHGSGFLAMAGVKVP
DKFVLDGGNRSAEECAARCAGNCSCMAYAYAKLQSSSAKGDVRRCLLWAGDLVDTQMIGP
LWASLADTLYLRVPLPPAGSAGSEVLHTIILSSSLFISISKHAMLIGDEMLGTSKFTEKG
RKTESQKKLVPGSANTSTEIGEGEHAEDLEFPSVRFVDIVAATGNFSKAFMIGRGGFGKV
YKGTLESGREVAVKRLSKDSDQGTEEFKNEAILIAKLQHRNLVRLLGCCTEGAEKLLIYE
YLPNKGLDAILFDSERKSVLDWPTRLEIIKGVARGLLYLHQDSRLTVIHRDLKASNVLLD
AEMRPKIADFGMAKIFCDNQQNANTKRVVGTFGYIAPEYSTEGVFSVKSDVYSFGVLLLE
IVSGVRISSPDDIMEFPSLIVYAWNLWREGKAGGLVDPSIAGSCSQEEALLCIHVGLLCV
EGDPSRRPLMSAVVSILENGSGSSSSTLSLPKPNQPAYLALMEAKRDDLENTRNSITMTV
LQGR
Download sequence
Identical sequences I1ISK5
EG:BRADI4G37220.1 15368.BRADI4G37220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]