SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G39310.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G39310.1
Domain Number 1 Region: 7-167,271-438
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.65e-115
Family Eukaryotic glutathione synthetase ATP-binding domain 0.000003
Further Details:      
 
Domain Number 2 Region: 170-273
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.2e-35
Family Eukaryotic glutathione synthetase, substrate-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G39310.1   Gene: BRADI4G39310   Transcript: BRADI4G39310.1
Sequence length 439
Comment pep:novel chromosome:Brachy1.0:4:43939361:43942005:1 gene:BRADI4G39310 transcript:BRADI4G39310.1
Sequence
MSARSGKAPGVGLLHAPFALLPMSFPKVYWEQALELAPLFNELVHRVSLDGEFLQQTLAR
TKEADSFTRRLLEIHSKMMEINKKEEIQLGLTRSDYMVDGATDRLLQVELNTISTSSNGL
ACGVCELHRNLIRHHERELGLDPSGVVGNTAITQHAEALASAWAEYNNQRAVVVVVVQAE
ERYMYDQYWITVALREMYGVTTVRKTMAEIEVEGELRPDGTLVINGSPVAVVYLRAGYSP
NDYPSEAEWRARLLIERSSAIKCPSIAHHLVGTKKIQQELAKENVLERFLDNKSDIEKVR
KCFAGLWSLENDSIVRSAIESPELFVLKPQREGGGNNIYGDNLRETLIRLRRGGSNEIAA
YILMQRIFPPASLSYLVREGICVRENAVSEFGVFGAYLRNKDKVIINDQCGYLLRTKAAS
LNEGGVVAGFAFLNCIFLS
Download sequence
Identical sequences I1ITB3
EG:BRADI4G39310.1 XP_010238571.1.954 15368.BRADI4G39310.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]