SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G39450.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G39450.1
Domain Number 1 Region: 15-87
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0000109
Family Kix domain of CBP (creb binding protein) 0.0041
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G39450.1
Domain Number - Region: 160-263
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0837
Family C-terminal domain of PLC-beta 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G39450.1   Gene: BRADI4G39450   Transcript: BRADI4G39450.1
Sequence length 753
Comment pep:novel chromosome:Brachy1.0:4:44068819:44071642:-1 gene:BRADI4G39450 transcript:BRADI4G39450.1
Sequence
MAQPPAGGGGGGGGHHWLATAPPDLRAKVVRKIIKTLPRPNGPPDQHQLAHLHAVASRYE
ARVFGAATSMQDYITTVSKKMTQIQNRDQTSAHAASNLQQPAQMGSQMQQANAAQANYSV
RPLQMAPAARPSATHQTQHPPSHISSGLCNLQPQPQPQPRLMGIMNQQHLRRVNQMQRVQ
QANVAVMQNGHPGGQNKNNQQYESPPTSEIITRNNAEEVEWREDLFQKITSLKDAHFTEL
MEYDRALDVCDITNEQFESMPEKKADRCRKLQKIKGMIQTVLSFLQLQKGNIPKQAMGQL
GKFQDIISGLRQFFRMERKKATIAARNCRELPHVASPAGTTAPPTSGMDTQHEHREVPAV
ETISSQPTQSSPTRSTPLALEPNESNTANLAGEAEDDGQAEMLGEAGAPVADAATFTGGT
CSQEEHPADETVIPQMSQNVPPGGTYSQEEDQENTEDEPVISELTQNAPPEGTCIQEEEQ
QEQAVIIPELTQNVPPGGMTQPAQQQDRSADQAESPNEACVTAEAPVSMDQPPIKSGDKA
EALRGLARELGLNLGRSTRLRRTIDSVSCEEEETSEPESKRQKMQSFGYGYITDRVLDEV
RDAHRALLETEVSIISDTTGAAAAADGPSMVVGFFYTAVTLPPDFRGAFEVSEVYAKLLV
PADYPRSSPAVLPRGELREGFPCSVDAAFQDAFSKLPEHRSIVDIARAFDSCVRSVVAEF
VKMIRMWELESYMESRRQYMQNYDPRMGSCICK
Download sequence
Identical sequences I1ITC8
15368.BRADI4G39450.1 EG:BRADI4G39450.1 XP_010239467.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]