SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G40430.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G40430.1
Domain Number 1 Region: 89-384
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-93
Family Protein kinases, catalytic subunit 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G40430.1   Gene: BRADI4G40430   Transcript: BRADI4G40430.1
Sequence length 613
Comment pep:novel chromosome:Brachy1.0:4:44811835:44815081:-1 gene:BRADI4G40430 transcript:BRADI4G40430.1
Sequence
MGCLCSKGAKDHVDATSEKRTPSRKDGPAAAASVKTASDGSKVMPDVGDNVVVSFDVRIS
SSNNAELNAGWPAWLVNVAPKAVEGWLPRQADSFEKLDKVGQGTYSIVYKARDLETGKIV
ALKKVRFTNMDPESVRFMAREIHILRRLDHPNIIKLEGIVTSRASQSLYLVFEYMEHDLS
GLIASPSLKLTEPQIKCFVQQLLHGLDHCHKNGVLHRDIKGSNLLIDSNGTLKIADFGLA
ITYDPNNPQPLTSRVVTLWYRPPELLLGATEYGVAVDMWSTGCIVAELFTGKPIMPGRTE
VEQIHKIFKLCGSPMEDYCNKSKVPETAMFKPQQQYRRCVAETFKVFSPSAVVLIDSLLS
LEPQVRGTASSALQSEFFRTEPLACDPSSLPNIPPSKEYDVRLRQEEAKRQKNAALGGRG
AESFKPGNENHVTSHAINGAAESKEHTNTSSRCNSVKFNPEDSVPGFRVEPRPSPTTVQA
PGYGSAWNTAGFTDHSAVPSRVCSSVHVANTAASRAKASSHSHIPQFGTTDLRNAADQVA
DQNEPPDRPASSHKKNPPEVKDNMNHGRKFRRIHHSGPLVPPGGNMEDMLKEHERHIQEA
VRKARFGKVAREL
Download sequence
Identical sequences I1ITP1
EG:BRADI4G40430.1 15368.BRADI4G40430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]