SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G40990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G40990.1
Domain Number 1 Region: 276-596
Classification Level Classification E-value
Superfamily RNI-like 2.9e-52
Family 28-residue LRR 0.048
Further Details:      
 
Domain Number 2 Region: 703-963
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.27e-39
Family Protein kinases, catalytic subunit 0.00089
Further Details:      
 
Domain Number 3 Region: 94-350
Classification Level Classification E-value
Superfamily L domain-like 6.29e-36
Family Polygalacturonase inhibiting protein PGIP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G40990.1   Gene: BRADI4G40990   Transcript: BRADI4G40990.1
Sequence length 967
Comment pep:novel chromosome:Brachy1.0:4:45238892:45242769:1 gene:BRADI4G40990 transcript:BRADI4G40990.1
Sequence
MEERRRYCSCSSHGLSPPLPLFFFSFLCLHLSMAAPAGGTPPLPLNSTQESVMRDLLSLV
GRRAGWNTTVSNPCLWSGIACSPSNSGSFSVVTNITLSAHGVSNSSIFATICAIDTLLSL
DLSRNSFTDFGDRLFSPSCSMKEGLRSLNLSSNQAASSLGGFSGFPRLEVFDLSFNLVRG
NLSTELGSFPQLRSLNLSTNNLSGGVPTSMVPSLEELVLSGNQLRGPIPPGLFSYGELVM
LDLSQNNLTGDVPDELWKLDKLQTLLISGNELSGAIPGRLSNSTMLSRYAANKNRFTGPI
PNGITEHVKMLDLSYNTLSGNIPSDLLASPVLQAIDLTSNRLEGSIPRNFSARLFRLRLG
MNLLTGRIPDSIGNASKLAYLELDNNNLSGDIPPQLGRCKELALLNLASNVLQGQVPDQI
STLEKLVVLKLQMNNLSGPIKSTFSSLTNLSILNLSRNSFSGEMPQNIEQLSKLSSMNLA
GNKISGVIPVSVSSLRLLIELNLGDNSLTGTIPDMPDKLSSSLNLSHNYLTGSIPSKIGT
LTDLEILDLSYNNLSGAVPSTLENLHSLTQLVLSYNQLSGYFHLPPHVVVNITGNPGLKI
RSDTYGNDTPVDGKTKNHAVLVTIFAIVGALVGLCLLAAVIMFSLSKRFCRFEDIGPPPE
QALPQIINDHIITTNSIHTSAIEFTYAMKAVSKPTNIFLKTRFCTYYKAVMPNRSIYSVK
KLDWSDKIFQIGSQEKFGHELEVLGKLSNSNVMVPLAYALTEDNAYLLYEHVYKGTVFDL
LHDGRSDVLDWPSRYSIALGVAQGLTFLHGRTQPVLLLDLSTRTIHLKSRNEPQIGDIEL
YKIIDPSKSSGSLSTIAGTVGYIPPEYAYTMRLTMAGNVYSFGVILLELLTGKPSVSDGM
ELAKWALSLSARPDQREQVLDTRVSRSSVGVHSQMLSVLNIALACVAFSPDARPKMRAVL
RTLLNAK
Download sequence
Identical sequences I1ITV4
EG:BRADI4G40990.1 15368.BRADI4G40990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]