SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G41000.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G41000.1
Domain Number 1 Region: 242-459
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.82e-63
Family CAT-like 0.00013
Further Details:      
 
Domain Number 2 Region: 40-129
Classification Level Classification E-value
Superfamily Single hybrid motif 2.75e-23
Family Biotinyl/lipoyl-carrier proteins and domains 0.00042
Further Details:      
 
Domain Number 3 Region: 176-220
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000706
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G41000.1   Gene: BRADI4G41000   Transcript: BRADI4G41000.1
Sequence length 461
Comment pep:novel chromosome:Brachy1.0:4:45243855:45247675:1 gene:BRADI4G41000 transcript:BRADI4G41000.1
Sequence
MAGLLHLNSTLLPSASLLLRNRSGGQAVRRRRACRVEAKIREIFMPALSSTMTEGKIVAW
NAAEGDRLAKGDPVVVVESDKADMDVETFYDGFLAAVLVPAGESAPVGSAIALLAESEDE
IPLAQSQAASFSSSSSSSSSSSPPAPQETAAQEASPPPPPPAPVAVSAPAPPSPAAQGGA
RVVASPYAKKLAKELSVDLFSITGSGPAGRVVAKDVEAAAAAPAKKAVPVAAARPDVPLG
STVPFTTMQGAVSKNMLESLAVPTFRVGYTITTGALDDLYKKIKGKGVTMTALLAKATAM
ALVQHPVVNSSCRDGQSFTYNSSINIAVAVAIDGGLITPVLQDADKLDIYTLSRKWKELV
DKARAKQLQPQEYNSGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPTVVGTKDGRI
GIKNQMQVNVTADHRVIYGSDLAAFLQTLSKIIEDPKDLTF
Download sequence
Identical sequences I1ITV5
15368.BRADI4G41000.1 EG:BRADI4G41000.1 XP_003578824.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]