SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G41870.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G41870.2
Domain Number 1 Region: 125-386
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.95e-81
Family Protein kinases, catalytic subunit 0.0000147
Further Details:      
 
Domain Number 2 Region: 28-95
Classification Level Classification E-value
Superfamily ACT-like 0.000000000625
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G41870.2   Gene: BRADI4G41870   Transcript: BRADI4G41870.2
Sequence length 407
Comment pep:novel chromosome:Brachy1.0:4:45819310:45824891:-1 gene:BRADI4G41870 transcript:BRADI4G41870.2
Sequence
MDSTYDSDASDEVADDGDDLSVRQDTPYTHIHEIVFSTIDKPKLLSQLSALLSDIGLNIR
EAHVFSTADGYSLDVFVVDGWPIEDTDGLHKALEASVLRNEGSWSGSSHSSAAERTLPFQ
VKGGEWEIDKRLLKMGDMIASGSCGDLFHGTYFGEDVAVKVLKAEHLNKNVWNEFTQEVY
ILREVCHTNVVRFIGACTKPPKFCIITEYMSGGSLYDFVHKQRNVLDLPTLLKFACDVCR
GMCYLHQRGIIHRDLKTANLLMDKDHVVKVADFGVARFQDQGGIMTAETGTYRWMAPEVI
NHQPYDNKADVFSFAIVLWELIASKIPYDTMTPLQAAVGVRQGLRPGLPENTHPKLLDLL
QRCWETIPSNRPSFPDILTELEDLLAEVQGTLGETSERPKDVSTSAN
Download sequence
Identical sequences I1IU53
EG:BRADI4G41870.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]