SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI4G43690.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI4G43690.1
Domain Number 1 Region: 505-802
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-73
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 63-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-28
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  EG:BRADI4G43690.1
Domain Number - Region: 341-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000118
Family Pan module (APPLE domain) 0.065
Further Details:      
 
Domain Number - Region: 243-280
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0672
Family alpha-D-mannose-specific plant lectins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI4G43690.1   Gene: BRADI4G43690   Transcript: BRADI4G43690.1
Sequence length 810
Comment pep:novel chromosome:Brachy1.0:4:47307279:47309725:-1 gene:BRADI4G43690 transcript:BRADI4G43690.1
Sequence
MVPALPTHLSIVLSFFILVSSAVSRDTLQLGSSIAIEAYRSEILQSPDGTFSCGFYSVYD
HAFTFSIWYSDAANKTVVWSANHDRPVHERRSSLTLRKDGSMVLKDYDDTVVWQAGDGNL
RNVQHAQLLDTGNLVIKDTSGNIIWQSFDSPTDTLLPGQRITAATKLVPTTQSRVPGNYI
FRFNDLSVLSLIYDVPDVSDIYWPNPDNSVYDNSRNRYNSTRLGILDSNGTLASSDFADG
ALLKASDSAPGTKRRLTLDPDGNLRLYSLNDSDGFWSVSMVAISQPCTIHGLCGPNGICH
YSPEPTCSCPPGYVMRNPGNWTEGCTASFNITCPGQEPMEFVKLPHTDFWGSDQQRLLGV
SFEACRKICISDCSCKGFQYQHGSGSCYPKAHLFSGKSCATPSVRTMYVKLPARLNVSDS
PIPQSGVLESAPPRLDCNQMSRGIRDPFPDVQKTGDGESKWIYFYGFIIAIFVVEISFMI
CAWFFVLRTELRPSEMWAAEEGYKVMTSHFRRYSYRELAKATRQFKVELGRGRLGVVYKG
VLEDERTVAVKMLENISQGKEEFQAELSVIGRIYHMNLARIWGFCSEGSHRMLVYEYVEN
GSLANILSNDQKNIVLDWKQRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDSDSE
PKIADFGLAKLLNRGGSSQNMSQVRGTAGYIAPEWVSGLPITAKVDVYSYGVVLLELLSG
SRVSELAVGSDAEVHIMLHKLVRALADKLEGNEESWIDEFVDHELSGQFSYLEARTLIEV
AVSCLWEDINKRPTMESVVQTLMSFDEASH
Download sequence
Identical sequences I1IUS5
XP_003578982.1.954 XP_014758275.1.954 XP_014758276.1.954 XP_014758277.1.954 EG:BRADI4G43690.1 15368.BRADI4G43690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]