SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G01210.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G01210.1
Domain Number 1 Region: 276-592
Classification Level Classification E-value
Superfamily RNI-like 7.85e-70
Family 28-residue LRR 0.063
Further Details:      
 
Domain Number 2 Region: 770-1071
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-69
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 3 Region: 42-379
Classification Level Classification E-value
Superfamily L domain-like 2.61e-57
Family Polygalacturonase inhibiting protein PGIP 0.023
Further Details:      
 
Domain Number 4 Region: 567-674
Classification Level Classification E-value
Superfamily L domain-like 1.16e-16
Family Polygalacturonase inhibiting protein PGIP 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G01210.1   Gene: BRADI5G01210   Transcript: BRADI5G01210.1
Sequence length 1150
Comment pep:novel chromosome:Brachy1.0:5:1122538:1126516:-1 gene:BRADI5G01210 transcript:BRADI5G01210.1
Sequence
MHLQHKHNFFFFLLILLNLFFFLFVTTTDSASSPNSEAAFLSSWLSASPARPPDWSPSSP
SPCNWSHITCSPAGAVTGVAFQSVHLAVPLPAGLCAALPWLASFVVSDSNLTGGVPEDLS
QCRRLATLDLSANSLSGEIPASLANATALESLILNSNQLTGPIPGDLAPSLRELFLFDNR
LSGELPPSLGKLRLLESLRLGGNHELSGEIPDSLSALSNLAVLGLADTKISGQIPPSFGK
LGSLATLSIYTTSLSGPIPPELGGCGNLTDVYLYENSLSGPIPPELGKLGKLQKLLLWQN
SLTGPIPNTFGALSSLVSLDLSINSISGAIPPELGRLPALQDLMLSDNNLTGAIPAALAN
ATSLVQLQLDTNEISGLIPPELGRNLVNLQVLFAWQNRLEGKIPAELAAMASLQALDLSH
NRLTGAIPPGLFLLKNLTKLLILSNDLSGVIPPEIGKAEKLVRLRLAGNRIAGSIPRAVA
GMKSVVFLDLGSNNLGGSIPNEISLCQQLQMLDLSNNTLTGSLPESLAGVRGLQELDVSH
NKLTGALPESFGKLESLSRLVLAGNALSGPIPSALGKCGALELLDLSDNGFSGGIPDELC
NLDGLDIALNLSRNSLTGPIPGKISQLGKLSVLDVSYNALGGGLMPLAGLENLVTLNVSH
NNFTGYLPDTKLFRQLSPGSLLAGNAGLCTTGGDVCFRRNGGAGDGEEGDEARVRRLKLA
IALLVTATVAMVVGMIGILRARQMKMAGKGGGHGSGSESEGGGGWPWQFTPFQKVSFSVE
QVVRSLVDANVIGKGVHGVVYRVCLDSGETIAVKKLWPATTAAADIMGKDAGRDSFSAEV
RTLGTIRHKNIVRFLGCCWNRSTRLLMYDYMPNGSLGAVLHERGSNGGSGGGAQLEWDVR
YRIVLGSAQGLAYLHHDCSPPIVHRDIKANNILIGLDFEPYIADFGLAKLVDDDANFGRS
SNTVAGSYGYIAPEYGYMMKITEKSDVYSYGVVVLEVLTGKQPIDPTIPDGQHVVDWVRR
HKGGAAVLDPALRGRSDTEVEEMLQVMGVALLCVSPTPDDRPTMKDVAALLKEIRLEREE
YAKVDVLLLKGGGGGGGELPTNAAATMPVTTKATTSTSSTPPYRQGPGSSSNSSSLSALY
SSSKAKSPFG
Download sequence
Identical sequences I1IVM5
15368.BRADI5G01210.1 EG:BRADI5G01210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]