SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G03060.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G03060.1
Domain Number 1 Region: 401-685
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-66
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G03060.1
Domain Number - Region: 306-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000153
Family EGF-type module 0.0089
Further Details:      
 
Domain Number - Region: 268-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G03060.1   Gene: BRADI5G03060   Transcript: BRADI5G03060.1
Sequence length 722
Comment pep:novel chromosome:Brachy1.0:5:3378683:3381628:-1 gene:BRADI5G03060 transcript:BRADI5G03060.1
Sequence
MSTAAALILLLVALSAPTTVESQTISPECPASCTGVDIPYPFGIGAAGSGCFREGFEISC
TNNGTDLPVFANKSTPVVNLYVYPPSSQVMLPIGYQCYKLSRSPSNNRTEVKSNGTSNAK
TNNISIDGVHRISNTRNMLVVLGCATVALVKNNYKNGTLGTASGCLSFCRHADAAQDGDC
TGIGCCKVDTMPEFDGTTAFEFLMRVSGRSRMLTYSPCDYAFLVAKNNYTFQKSDLMSME
TSRTMPVNLDWAIRDSSSCADATDPKYACKSNNSRCVNSTNGPAGYTCRCKDGYEGNAYL
PGGCNDIKECRNKTKHCAGNDCVEMDGSFKCGCPTGYWSNDPNTVPCTPDAELQLAAKLA
IGITLGISFLLIAVLSTLLKLQRRRTKGFFKKNGGLTLRNVGTLNIFTKEEIKKITKNNS
EVLGRGCFGKVYKGILPNGTAVAVKTSIEINKARKEEFTKEVEIQSQMIHKNIIKLMGCC
LEVDVPMLVYEFAANGSLQDILHGKTSVLPNFPLDLRLDIAIDAAEGLAYMHSSTTHTIR
HGDVKPANILLDDKNMPKISDFGTSKFLTKDKDHTVLVVGSMEYIDPMFSETGQLTQKSD
VYNFGVVLLELITRKPIVYDGSRRLVVEFRDIYRKENSGGSMFDKDIATEEDTYILEEIA
KLAVMCLRKDVEERPEMKEVAERLAMLRRARKSGNINHKSPQYFEEIGADGAPMSFTSEI
NN
Download sequence
Identical sequences I1IW53
EG:BRADI5G03060.1 XP_003581026.1.954 15368.BRADI5G03060.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]