SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI5G03070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI5G03070.1
Domain Number 1 Region: 476-763
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.91e-64
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Weak hits

Sequence:  EG:BRADI5G03070.1
Domain Number - Region: 340-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000118
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI5G03070.1   Gene: BRADI5G03070   Transcript: BRADI5G03070.1
Sequence length 794
Comment pep:novel chromosome:Brachy1.0:5:3386697:3390593:1 gene:BRADI5G03070 transcript:BRADI5G03070.1
Sequence
MNTHSQYSQLLLILLLAVLQPVVGAAADEHDRIEADAQPLMARRSCREKCGDMSIPFPFG
MEKTDCFLPGFEVTCNFSFDPPRAFLAYDDKGGSTNQTYQVIYQSGFKSNGEGIDLGKSL
RPVELFNISLEKSEVRVYGAINSRCFSNFTQDLLKGKYMVLDTEGPFLLSSTRNALIGVG
WNVQPLMSDNFESTTGYSFTLSCTSYLAISLEMATNGSCTGLGCCQVALPKQRLPVTITG
ISFKDEKSNPRWATNPCSYGMAVEKSWYNFSTEDIYGYEVLSNKLSRGFPLVLDFAIRNG
SCQDGGCLSGNSSCANAKNGPGYSCKCWDFYHGNPYITGGCQDIDECQLRDQNPELLDFY
PCSTDGICNNRLGGYDCPCKRGMKGDGKKGNCTEIFPLAAKIVVAQPHPTKVQILNLDNR
FHQAILGKAVSQNTNQNTGHVKKQSGCLASLIVAFVLMVMTKQHLKLRKFYGQNGGPVLN
GVKNIRIYTRKQLKQITNNYERVIGEGHFGKVYMGTLKDKQQVAVKKSIKVDKEMKREFT
DEVIIQSAMRHKNIAMLIGCCLEMDVPMLVYEFVARGSLYDVLFKGRDSIPANRRLDIAI
GSAEGLTYMHSAVESTIRHGDVKSANILLDEYFTPKVSDFGTSKLLAKGKSETAERVVGD
KSYIDPVYMEMGILTQKSDVYGFGIVLIELVTRRAATYDNNRSYVANFVQACLDKRARNF
IDNDITSEVDLKLLEMVSGVAVECLKPNPEERPDMKQVEHRLLEIVGEALQSGQGRNYQP
DLSPAPDDVALLKA
Download sequence
Identical sequences I1IW54
15368.BRADI5G03070.1 EG:BRADI5G03070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]